Details of the Target

General Information of Target

Target ID LDTP09047
Target Name Transmembrane protein 229B (TMEM229B)
Gene Name TMEM229B
Gene ID 161145
Synonyms
C14orf83; Transmembrane protein 229B
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MASAEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNLNWKFPGVTSVWALFIYGTSILIV
ERMYLRLRGRCPLLLRCLIYTLWTYLWEFTTGFILRQFNACPWDYSQFDFDFMGLITLEY
AVPWFCGALIMEQFIIRNTLRLRFDKDAEPGEPSGALALANGHVKTD
Target Bioclass
Other
Family
TMEM229 family
Subcellular location
Membrane
Uniprot ID
Q8NBD8
Ensemble ID
ENST00000357461.7
HGNC ID
HGNC:20130

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		C71(3.01)  LDD2229  [1]
ENE
 Probe Info  		N.A.  LDD0006  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
Glutathione S-transferase 3, mitochondrial (MGST3) MAPEG family O14880
MYG1 exonuclease (MYG1) MYG1 family Q9HB07
Phosphatidylinositol N-acetylglucosaminyltransferase subunit P (PIGP) PIGP family P57054
17-beta-hydroxysteroid dehydrogenase 13 (HSD17B13) Short-chain dehydrogenases/reductases (SDR) family Q7Z5P4
ADP-ribosylation factor-like protein 13B (ARL13B) Arf family Q3SXY8
TLC domain-containing protein 4 (TLCD4) TLCD4 family Q96MV1
Peptidyl-prolyl cis-trans isomerase FKBP7 (FKBP7) . Q9Y680
Transporter and channel
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Sodium-dependent organic anion transporter (SLC10A6) Bile acid:sodium symporter (BASS) family Q3KNW5
Novel acetylcholine receptor chaperone (TMEM35A) DoxX family Q53FP2
LHFPL tetraspan subfamily member 5 protein (LHFPL5) LHFP family Q8TAF8
Hippocampus abundant transcript-like protein 1 (MFSD14B) Major facilitator superfamily Q5SR56
ER membrane protein complex subunit 5 (MMGT1) Membrane magnesium transporter (TC 1.A.67) family Q8N4V1
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Pannexin-1 (PANX1) Pannexin family Q96RD7
Leukocyte surface antigen CD53 (CD53) Tetraspanin (TM4SF) family P19397
Transmembrane protein 14B (TMEM14B) TMEM14 family Q9NUH8
Vesicle-associated membrane protein-associated protein A (VAPA) VAMP-associated protein (VAP) (TC 9.B.17) family Q9P0L0
Zinc transporter ZIP2 (SLC39A2) ZIP transporter (TC 2.A.5) family Q9NP94
Transcription factor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cyclic AMP-responsive element-binding protein 3-like protein 1 (CREB3L1) BZIP family Q96BA8
Immunoglobulin
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Poliovirus receptor (PVR) Nectin family P15151
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
V-type immunoglobulin domain-containing suppressor of T-cell activation (VSIR) . Q9H7M9
Other
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Complexin-4 (CPLX4) Complexin/synaphin family Q7Z7G2
Receptor expression-enhancing protein 4 (REEP4) DP1 family Q9H6H4
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein FAM209A (FAM209A) FAM209 family Q5JX71
RAB6-interacting golgin (GORAB) GORAB family Q5T7V8
Integrin alpha-M (ITGAM) Integrin alpha chain family P11215
Vesicle-trafficking protein SEC22b (SEC22B) Synaptobrevin family O75396
Synaptotagmin-2 (SYT2) Synaptotagmin family Q8N9I0
Transmembrane protein 45B (TMEM45B) TMEM45 family Q96B21
Bcl-2-interacting killer (BIK) . Q13323

References

1 A quantitative thiol reactivity profiling platform to analyze redox and electrophile reactive cysteine proteomes. Nat Protoc. 2020 Sep;15(9):2891-2919. doi: 10.1038/s41596-020-0352-2. Epub 2020 Jul 20.
Mass spectrometry data entry: PXD016048
2 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764