Details of the Target
General Information of Target
| Target ID | LDTP08996 | |||||
|---|---|---|---|---|---|---|
| Target Name | Nuclear envelope phosphatase-regulatory subunit 1 (CNEP1R1) | |||||
| Gene Name | CNEP1R1 | |||||
| Gene ID | 255919 | |||||
| Synonyms |
C16orf69; TMEM188; Nuclear envelope phosphatase-regulatory subunit 1; NEP1-R1; Transmembrane protein 188 |
|||||
| 3D Structure | ||||||
| Sequence |
MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSF
FTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP RPHVQ |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
CNEP1R1 family
|
|||||
| Subcellular location |
Nucleus membrane
|
|||||
| Function |
Forms with the serine/threonine protein phosphatase CTDNEP1 an active complex which dephosphorylates and may activate LPIN1 and LPIN2. LPIN1 and LPIN2 are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at different levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C23(0.89); C110(1.09) | LDD1492 | [1] | |
Competitor(s) Related to This Target

