Details of the Target
General Information of Target
| Target ID | LDTP08990 | |||||
|---|---|---|---|---|---|---|
| Target Name | V-type proton ATPase subunit d 2 (ATP6V0D2) | |||||
| Gene Name | ATP6V0D2 | |||||
| Gene ID | 245972 | |||||
| Synonyms |
V-type proton ATPase subunit d 2; V-ATPase subunit d 2; Vacuolar proton pump subunit d 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MLEGAELYFNVDHGYLEGLVRGCKASLLTQQDYINLVQCETLEDLKIHLQTTDYGNFLAN
HTNPLTVSKIDTEMRKRLCGEFEYFRNHSLEPLSTFLTYMTCSYMIDNVILLMNGALQKK SVKEILGKCHPLGRFTEMEAVNIAETPSDLFNAILIETPLAPFFQDCMSENALDELNIEL LRNKLYKSYLEAFYKFCKNHGDVTAEVMCPILEFEADRRAFIITLNSFGTELSKEDRETL YPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM NVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPIL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
V-ATPase V0D/AC39 subunit family
|
|||||
| Function |
Subunit of the V0 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment. May play a role in coupling of proton transport and ATP hydrolysis. Regulator of osteoclast fusion and bone formation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C79(1.94); C334(1.87) | LDD3314 | [1] | |
Competitor(s) Related to This Target

