Details of the Target

General Information of Target

Target ID LDTP08963
Target Name Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2)
Gene Name TRIML2
Gene ID 205860
Synonyms
SPRYD6; Probable E3 ubiquitin-protein ligase TRIML2; EC 2.3.2.27; RING-type E3 ubiquitin transferase TRIML2; SPRY domain-containing protein 6; Tripartite motif family-like protein 2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSKRLSPQLQHNITEDAYCETHLEPTRLFCDVDQITLCSKCFQSQEHKHHMVCGIQEAAE
NYRKLFQEILNTSREKLEAAKSILTDEQERMAMIQEEEQNFKKMIESEYSMRLRLLNEEC
EQNLQRQQECISDLNLRETLLNQAIKLATELEEMFQEMLQRLGRVGRENMEKLKESEARA
SEQVRSLLKLIVELEKKCGEGTLALLKNAKYSLERSKSLLLEHLEPAHITDLSLCHIRGL
SSMFRVLQRHLTLDPETAHPCLALSEDLRTMRLRHGQQDGAGNPERLDFSAMVLAAESFT
SGRHYWEVDVEKATRWQVGIYHGSADAKGSTARASGEKVLLTGSVMGTEWTLWVFPPLKR
LFLEKKLDTVGVFLDCEHGQISFYNVTEMSLIYNFSHCAFQGALRPVFSLCIPNGDTSPD
SLTILQHGPSCDATVSP
Target Bioclass
Enzyme
Uniprot ID
Q8N7C3
Ensemble ID
ENST00000512729.5
HGNC ID
HGNC:26378

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HDMYZ SNV: p.V310E .
HGC27 SNV: p.C30S .
HS936T SNV: p.S409F .
HT115 SNV: p.A92T .
HT1197 SNV: p.E364K .
JVM3 SNV: p.P406T .
MEWO SNV: p.E175K .
NCIH358 SNV: p.S218Ter .
SW403 SNV: p.E256K .
TE10 SNV: p.R286T .
TE4 SNV: p.E388D .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
TFBX
 Probe Info  		N.A.  LDD0148  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
DNA-directed RNA polymerase I subunit RPA12 (POLR1H) Archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family Q9P1U0
tRNA-splicing endonuclease subunit Sen54 (TSEN54) SEN54 family Q7Z6J9
Tumor susceptibility gene 101 protein (TSG101) Ubiquitin-conjugating enzyme family Q99816
E3 SUMO-protein ligase ZBED1 (ZBED1) . O96006
Probable E3 ubiquitin-protein ligase TRIML2 (TRIML2) . Q8N7C3
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Nuclear pore glycoprotein p62 (NUP62) Nucleoporin NSP1/NUP62 family P37198
Transcription factor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
NF-kappa-B inhibitor delta (NFKBID) NF-kappa-B inhibitor family Q8NI38
POU domain, class 6, transcription factor 2 (POU6F2) POU transcription factor family P78424
Homeobox protein MOX-1 (MEOX1) . P50221
Transcriptional regulator Kaiso (ZBTB33) . Q86T24
Other
Click To Hide/Show 29 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Biogenesis of lysosome-related organelles complex 1 subunit 2 (BLOC1S2) BLOC1S2 family Q6QNY1
Cerebellar degeneration-related protein 2 (CDR2) CDR2 family Q01850
Cyclin-H (CCNH) Cyclin family P51946
Translation initiation factor eIF2B subunit alpha (EIF2B1) EIF-2B alpha/beta/delta subunits family Q14232
Eukaryotic translation initiation factor 3 subunit M (EIF3M) EIF-3 subunit M family Q7L2H7
Protein FAM9C (FAM9C) FAM9 family Q8IZT9
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
Inhibitor of growth protein 5 (ING5) ING family Q8WYH8
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cuticular Ha8 (KRT38) Intermediate filament family O76015
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 24 (KRT24) Intermediate filament family Q2M2I5
Keratin, type I cytoskeletal 27 (KRT27) Intermediate filament family Q7Z3Y8
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Methyl-CpG-binding domain protein 3-like 2 (MBD3L2) MBD3L family Q8NHZ7
Putative methyl-CpG-binding domain protein 3-like 3 (MBD3L3) MBD3L family A6NE82
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
CST complex subunit STN1 (STN1) STN1 family Q9H668
Synaptonemal complex central element protein 2 (SYCE2) SYCE family Q6PIF2
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
Centromere protein R (ITGB3BP) . Q13352
Coiled-coil domain-containing protein 146 (CCDC146) . Q8IYE0
Coiled-coil domain-containing protein 92 (CCDC92) . Q53HC0
Hepatocyte growth factor-regulated tyrosine kinase substrate (HGS) . O14964
PRKCA-binding protein (PICK1) . Q9NRD5
SH2 domain-containing protein 4A (SH2D4A) . Q9H788
TBC1 domain family member 25 (TBC1D25) . Q3MII6
XIAP-associated factor 1 (XAF1) . Q6GPH4

References

1 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255