Details of the Target
General Information of Target
| Target ID | LDTP08952 | |||||
|---|---|---|---|---|---|---|
| Target Name | G-protein coupled receptor 161 (GPR161) | |||||
| Gene Name | GPR161 | |||||
| Gene ID | 23432 | |||||
| Synonyms |
G-protein coupled receptor 161; G-protein coupled receptor RE2 |
|||||
| 3D Structure | ||||||
| Sequence |
MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVVTLYKKSYLLT
LSNKFVFSLTLSNFLLSVLVLPFVVTSSIRREWIFGVVWCNFSALLYLLISSASMLTLGV IAIDRYYAVLYPMVYPMKITGNRAVMALVYIWLHSLIGCLPPLFGWSSVEFDEFKWMCVA AWHREPGYTAFWQIWCALFPFLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRK NSSTSTSSSGSRRNAFQGVVYSANQCKALITILVVLGAFMVTWGPYMVVIASEALWGKSS VSPSLETWATWLSFASAVCHPLIYGLWNKTVRKELLGMCFGDRYYREPFVQRQRTSRLFS ISNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSH CTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLDSYAASLAKAIEAEAKINLFG EEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLAAEQR |
|||||
| Target Bioclass |
GPCR
|
|||||
| Family |
G-protein coupled receptor 1 family
|
|||||
| Subcellular location |
Cell projection, cilium membrane
|
|||||
| Function |
Key negative regulator of Shh signaling, which promotes the processing of GLI3 into GLI3R during neural tube development. Recruited by TULP3 and the IFT-A complex to primary cilia and acts as a regulator of the PKA-dependent basal repression machinery in Shh signaling by increasing cAMP levels, leading to promote the PKA-dependent processing of GLI3 into GLI3R and repress the Shh signaling. In presence of SHH, it is removed from primary cilia and is internalized into recycling endosomes, preventing its activity and allowing activation of the Shh signaling. Its ligand is unknown.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C224(1.19) | LDD1575 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0371 | CL102 | HEK-293T | C224(1.19) | LDD1575 | [1] |
| LDCM0375 | CL106 | HEK-293T | C224(0.96) | LDD1579 | [1] |
| LDCM0380 | CL110 | HEK-293T | C224(1.22) | LDD1584 | [1] |
| LDCM0384 | CL114 | HEK-293T | C224(1.16) | LDD1588 | [1] |
| LDCM0388 | CL118 | HEK-293T | C224(1.20) | LDD1592 | [1] |
| LDCM0393 | CL122 | HEK-293T | C224(1.05) | LDD1597 | [1] |
| LDCM0397 | CL126 | HEK-293T | C224(1.10) | LDD1601 | [1] |
| LDCM0401 | CL14 | HEK-293T | C224(1.18) | LDD1605 | [1] |
| LDCM0407 | CL2 | HEK-293T | C224(1.46) | LDD1611 | [1] |
| LDCM0414 | CL26 | HEK-293T | C224(1.11) | LDD1618 | [1] |
| LDCM0441 | CL50 | HEK-293T | C224(1.08) | LDD1645 | [1] |
| LDCM0454 | CL62 | HEK-293T | C224(1.07) | LDD1657 | [1] |
| LDCM0467 | CL74 | HEK-293T | C224(1.17) | LDD1670 | [1] |
| LDCM0480 | CL86 | HEK-293T | C224(1.17) | LDD1683 | [1] |
| LDCM0493 | CL98 | HEK-293T | C224(0.96) | LDD1696 | [1] |
| LDCM0427 | Fragment51 | HEK-293T | C224(1.06) | LDD1631 | [1] |

