Details of the Target
General Information of Target
| Target ID | LDTP08948 | |||||
|---|---|---|---|---|---|---|
| Target Name | Stress-associated endoplasmic reticulum protein 2 (SERP2) | |||||
| Gene Name | SERP2 | |||||
| Gene ID | 387923 | |||||
| Synonyms |
C13orf21; Stress-associated endoplasmic reticulum protein 2; Ribosome-associated membrane protein RAMP4-2 |
|||||
| 3D Structure | ||||||
| Sequence |
MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQS
IRMGM |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
RAMP4 family
|
|||||
| Subcellular location |
Membrane
|
|||||
| Function |
Interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. Protects unfolded target proteins against degradation during ER stress. May facilitate glycosylation of target proteins after termination of ER stress. May modulate the use of N-glycosylation sites on target proteins.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K16(7.57) | LDD0277 | [1] | |

