Details of the Target
General Information of Target
| Target ID | LDTP08941 | |||||
|---|---|---|---|---|---|---|
| Target Name | Keratinocyte-associated protein 2 (KRTCAP2) | |||||
| Gene Name | KRTCAP2 | |||||
| Gene ID | 200185 | |||||
| Synonyms |
KCP2; Keratinocyte-associated protein 2; KCP-2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2; Oligosaccharyl transferase subunit KCP2 |
|||||
| 3D Structure | ||||||
| Sequence |
MVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLEN
LVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAA PVLTPAKVTGKSKKRN |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
KRTCAP2 family
|
|||||
| Subcellular location |
Endoplasmic reticulum
|
|||||
| Function |
Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity. May be involved in N-glycosylation of APP (amyloid-beta precursor protein). Can modulate gamma-secretase cleavage of APP by enhancing endoprotelysis of PSEN1.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
 |
K131(2.08) | LDD0277 | [1] | |