Details of the Target
General Information of Target
| Target ID | LDTP08936 | |||||
|---|---|---|---|---|---|---|
| Target Name | EP300-interacting inhibitor of differentiation 2 (EID2) | |||||
| Gene Name | EID2 | |||||
| Gene ID | 163126 | |||||
| Synonyms |
CRI2; EP300-interacting inhibitor of differentiation 2; EID-2; CREBBP/EP300 inhibitor 2; EID-1-like inhibitor of differentiation 2 |
|||||
| 3D Structure | ||||||
| Sequence |
MSKLPADSSVPQTGAANGDRDVPQAEVGRGRREPAPAQPEEAGEGAMAAARGGPVPAARE
GRMAAARAAPAAAARGAPVAAAALARAAAAGRESPAAAAAREARMAEVARLLGEPVDEEG PEGRPRSRHGNGGLAALPYLRLRHPLSVLGINYQQFLRHYLENYPIAPGRIQELEERRRR FVEACRAREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Interacts with EP300 and acts as a repressor of MYOD-dependent transcription and muscle differentiation. Inhibits EP300 histone acetyltransferase activity. Acts as a repressor of TGFB/SMAD transcriptional responses. May act as a repressor of the TGFB/SMAD3-dependent signaling by selectively blocking formation of TGFB-induced SMAD3-SMAD4 complex.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
C185(7.48) | LDD1701 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target

