Details of the Target
General Information of Target
| Target ID | LDTP08921 | |||||
|---|---|---|---|---|---|---|
| Target Name | DNA damage-regulated autophagy modulator protein 1 (DRAM1) | |||||
| Gene Name | DRAM1 | |||||
| Gene ID | 55332 | |||||
| Synonyms |
DRAM; DNA damage-regulated autophagy modulator protein 1; Damage-regulated autophagy modulator |
|||||
| 3D Structure | ||||||
| Sequence |
MLCFLRGMAFVPFLLVTWSSAAFIISYVVAVLSGHVNPFLPYISDTGTTPPESGIFGFMI
NFSAFLGAATMYTRYKIVQKQNQTCYFSTPVFNLVSLVLGLVGCFGMGIVANFQELAVPV VHDGGALLAFVCGVVYTLLQSIISYKSCPQWNSLSTCHIRMVISAVSCAAVIPMIVCASL ISITKLEWNPREKDYVYHVVSAICEWTVAFGFIFYFLTFIQDFQSVTLRISTEINGDI |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
DRAM/TMEM150 family
|
|||||
| Subcellular location |
Lysosome membrane
|
|||||
| Function | Lysosomal modulator of autophagy that plays a central role in p53/TP53-mediated apoptosis. Not involved in p73/TP73-mediated autophagy. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
N.A. | LDD0005 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Clarin-1 (CLRN1) | Clarin family | P58418 | |||
| Membrane-spanning 4-domains subfamily A member 7 (MS4A7) | MS4A family | Q9GZW8 | |||
GPCR
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| G-protein coupled receptor 42 (GPR42) | G-protein coupled receptor 1 family | O15529 | |||
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Leucine-rich repeat-containing protein 4C (LRRC4C) | . | Q9HCJ2 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Complex I assembly factor TIMMDC1, mitochondrial (TIMMDC1) | Tim17/Tim22/Tim23 family | Q9NPL8 | |||
| Uncharacterized protein C1orf21 (C1orf21) | . | Q9H246 | |||
References

