Details of the Target

General Information of Target

Target ID LDTP08918
Target Name Lysoplasmalogenase TMEM86B (TMEM86B)
Gene Name TMEM86B
Gene ID 255043
Synonyms
Lysoplasmalogenase TMEM86B; EC 3.3.2.2; Transmembrane protein 86B
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MDAGKAGQTLKTHCSAQRPDVCRWLSPFILSCCVYFCLWIPEDQLSWFAALVKCLPVLCL
AGFLWVMSPSGGYTQLLQGALVCSAVGDACLIWPAAFVPGMAAFATAHLLYVWAFGFSPL
QPGLLLLIILAPGPYLSLVLQHLEPDMVLPVAAYGLILMAMLWRGLAQGGSAGWGALLFT
LSDGVLAWDTFAQPLPHAHLVIMTTYYAAQLLITLSALRSPVPKTD
Target Bioclass
Enzyme
Family
TMEM86 family
Subcellular location
Membrane
Function
Catalyzes the hydrolysis of the vinyl ether bond of choline or ethanolamine lysoplasmalogens, forming fatty aldehyde and glycerophosphocholine or glycerophosphoethanolamine, respectively and is specific for the sn-2-deacylated (lyso) form of plasmalogen.
Uniprot ID
Q8N661
Ensemble ID
ENST00000327042.5
HGNC ID
HGNC:28448

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IPM
 Probe Info  		C14(0.00); C22(0.00)  LDD0241  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 22 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cytochrome b5 type B (CYB5B) Cytochrome b5 family O43169
Palmitoyltransferase ZDHHC22 (ZDHHC22) DHHC palmitoyltransferase family Q8N966
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Probable glutathione peroxidase 8 (GPX8) Glutathione peroxidase family Q8TED1
3-hydroxyisobutyrate dehydrogenase, mitochondrial (HIBADH) HIBADH-related family P31937
Glutathione S-transferase 3, mitochondrial (MGST3) MAPEG family O14880
Mitochondrial Rho GTPase 2 (RHOT2) Mitochondrial Rho GTPase family Q8IXI1
Peroxynitrite isomerase THAP4 (THAP4) Nitrobindin family Q8WY91
Inactive ubiquitin thioesterase OTULINL (OTULINL) Peptidase C65 family Q9NUU6
Rhomboid-related protein 4 (RHBDD1) Peptidase S54 family Q8TEB9
Phosphatidylinositol-glycan biosynthesis class F protein (PIGF) PIGF family Q07326
Tyrosine-protein phosphatase non-receptor type 1 (PTPN1) Protein-tyrosine phosphatase family P18031
Tyrosine-protein phosphatase non-receptor type 9 (PTPN9) Protein-tyrosine phosphatase family P43378
17-beta-hydroxysteroid dehydrogenase 13 (HSD17B13) Short-chain dehydrogenases/reductases (SDR) family Q7Z5P4
Dehydrogenase/reductase SDR family member on chromosome X (DHRSX) Short-chain dehydrogenases/reductases (SDR) family Q8N5I4
ADP-ribosylation factor-like protein 13B (ARL13B) Arf family Q3SXY8
Fatty acid hydroxylase domain-containing protein 2 (FAXDC2) Sterol desaturase family Q96IV6
Methylsterol monooxygenase 1 (MSMO1) Sterol desaturase family Q15800
Lanosterol synthase (LSS) Terpene cyclase/mutase family P48449
Lysoplasmalogenase TMEM86B (TMEM86B) TMEM86 family Q8N661
E3 ubiquitin-protein ligase MARCHF2 (MARCHF2) . Q9P0N8
Peptidyl-prolyl cis-trans isomerase FKBP7 (FKBP7) . Q9Y680
Transporter and channel
Click To Hide/Show 32 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Stomatin (STOM) Band 7/mec-2 family P27105
Sodium-dependent organic anion transporter (SLC10A6) Bile acid:sodium symporter (BASS) family Q3KNW5
Interferon-induced transmembrane protein 3 (IFITM3) CD225/Dispanin family Q01628
Clarin-1 (CLRN1) Clarin family P58418
Gap junction alpha-1 protein (GJA1) Connexin family P17302
Gap junction alpha-4 protein (GJA4) Connexin family P35212
Gap junction alpha-8 protein (GJA8) Connexin family P48165
Membrane-associated progesterone receptor component 2 (PGRMC2) Cytochrome b5 family O15173
FXYD domain-containing ion transport regulator 6 (FXYD6) FXYD family Q9H0Q3
Lysosomal-associated transmembrane protein 4B (LAPTM4B) LAPTM4/LAPTM5 transporter family Q86VI4
ER membrane protein complex subunit 5 (MMGT1) Membrane magnesium transporter (TC 1.A.67) family Q8N4V1
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Membrane-spanning 4-domains subfamily A member 14 (MS4A14) MS4A family Q96JA4
Cardiac phospholamban (PLN) Phospholamban family P26678
Secreted frizzled-related protein 1 (SFRP1) Secreted frizzled-related protein (sFRP) family Q8N474
Solute carrier family 35 member G2 (SLC35G2) SLC35G solute transporter family Q8TBE7
Small integral membrane protein 1 (SMIM1) SMIM1 family B2RUZ4
Vesicle-associated membrane protein 2 (VAMP2) Synaptobrevin family P63027
Vesicle-associated membrane protein 3 (VAMP3) Synaptobrevin family Q15836
Syntaxin-6 (STX6) Syntaxin family O43752
Leukocyte surface antigen CD53 (CD53) Tetraspanin (TM4SF) family P19397
Mitochondrial import inner membrane translocase subunit Tim23 (TIMM23) Tim17/Tim22/Tim23 family O14925
Transmembrane protein 106A (TMEM106A) TMEM106 family Q96A25
Ion channel TACAN (TMEM120A) TMEM120 family Q9BXJ8
Transmembrane protein 14A (TMEM14A) TMEM14 family Q9Y6G1
Transmembrane protein 14C (TMEM14C) TMEM14 family Q9P0S9
Vesicle-associated membrane protein-associated protein A (VAPA) VAMP-associated protein (VAP) (TC 9.B.17) family Q9P0L0
Zinc transporter ZIP9 (SLC39A9) ZIP transporter (TC 2.A.5) family Q9NUM3
Phospholipid transfer protein C2CD2L (C2CD2L) . O14523
Thioredoxin-related transmembrane protein 2 (TMX2) . Q9Y320
Transmembrane protein 203 (TMEM203) . Q969S6
Transmembrane protein 60 (TMEM60) . Q9H2L4
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
G-protein coupled receptor 37-like 1 (GPR37L1) G-protein coupled receptor 1 family O60883
Immunoglobulin
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Junctional adhesion molecule A (F11R) Immunoglobulin superfamily Q9Y624
Killer cell immunoglobulin-like receptor 2DL3 (KIR2DL3) Immunoglobulin superfamily P43628
B-cell antigen receptor complex-associated protein alpha chain (CD79A) . P11912
Cytokine and receptor
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
C-C motif chemokine 4 (CCL4) Intercrine beta (chemokine CC) family P13236
Other
Click To Hide/Show 34 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ADP-ribosylation factor-like protein 6-interacting protein 6 (ARL6IP6) ARL6IP6 family Q8N6S5
Bcl-2-like protein 13 (BCL2L13) Bcl-2 family Q9BXK5
Complex I intermediate-associated protein 30, mitochondrial (NDUFAF1) CIA30 family Q9Y375
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein FAM209A (FAM209A) FAM209 family Q5JX71
Golgi membrane protein 1 (GOLM1) GOLM family Q8NBJ4
Guanylin (GUCA2A) Guanylin family Q02747
Ninjurin-2 (NINJ2) Ninjurin family Q9NZG7
ORM1-like protein 2 (ORMDL2) ORM family Q53FV1
Peroxisomal membrane protein 11C (PEX11G) Peroxin-11 family Q96HA9
Protein reprimo (RPRM) Reprimo family Q9NS64
Vesicle transport protein SFT2A (SFT2D1) SFT2 family Q8WV19
Sideroflexin-5 (SFXN5) Sideroflexin family Q8TD22
Vesicle-associated membrane protein 5 (VAMP5) Synaptobrevin family O95183
Vesicle-trafficking protein SEC22b (SEC22B) Synaptobrevin family O75396
Syntaxin-12 (STX12) Syntaxin family Q86Y82
Syntaxin-8 (STX8) Syntaxin family Q9UNK0
Bone morphogenetic protein 10 (BMP10) TGF-beta family O95393
Transmembrane protein 248 (TMEM248) TMEM248 family Q9NWD8
Receptor-transporting protein 2 (RTP2) TMEM7 family Q5QGT7
Vesicle transport protein USE1 (USE1) USE1 family Q9NZ43
Immediate early response 3-interacting protein 1 (IER3IP1) YOS1 family Q9Y5U9
Bcl-2-interacting killer (BIK) . Q13323
Coiled-coil domain-containing protein 167 (CCDC167) . Q9P0B6
DnaJ homolog subfamily C member 30, mitochondrial (DNAJC30) . Q96LL9
Endoplasmic reticulum resident protein 29 (ERP29) . P30040
Lck-interacting transmembrane adapter 1 (LIME1) . Q9H400
Lymphocyte antigen 6D (LY6D) . Q14210
Protein SNORC (SNORC) . Q6UX34
Serine-rich single-pass membrane protein 1 (SSMEM1) . Q8WWF3
Testis-expressed protein 29 (TEX29) . Q8N6K0
Thrombomodulin (THBD) . P07204
Transmembrane protein 107 (TMEM107) . Q6UX40
Transmembrane protein 52B (TMEM52B) . Q4KMG9

References

1 Oxidant-Induced Bioconjugation for Protein Labeling in Live Cells. ACS Chem Biol. 2023 Jan 20;18(1):112-122. doi: 10.1021/acschembio.2c00740. Epub 2022 Dec 21.