Details of the Target
General Information of Target
Target ID | LDTP08868 | |||||
---|---|---|---|---|---|---|
Target Name | Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase (PIP4P2) | |||||
Gene Name | PIP4P2 | |||||
Gene ID | 55529 | |||||
Synonyms |
TMEM55A; Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase; Type 2 PtdIns-4,5-P2 4-Ptase; EC 3.1.3.78; PtdIns-4,5-P2 4-Ptase II; Transmembrane protein 55A |
|||||
3D Structure | ||||||
Sequence |
MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAIASPDASGIPVINCRV
CQSLINLDGKLHQHVVKCTVCNEATPIKNPPTGKKYVRCPCNCLLICKDTSRRIGCPRPN CRRIINLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKI SSVGSALPRRRCCAYITIGMICIFIGVGLTVGTPDFARRFRATYVSWAIAYLLGLICLIR ACYWGAIRVSYPEHSFA |
|||||
Target Bioclass |
Enzyme
|
|||||
Subcellular location |
Late endosome membrane
|
|||||
Function |
Catalyzes the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PtdIns-4,5-P2) to phosphatidylinositol-4-phosphate (PtdIns-4-P). Does not hydrolyze phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 3,4-bisphosphate, inositol 3,5-bisphosphate, inositol 3,4-bisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate and phosphatidylinositol 3-monophosphate. Negatively regulates the phagocytosis of large particles by reducing phagosomal phosphatidylinositol 4,5-bisphosphate accumulation during cup formation.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
m-APA Probe Info |
![]() |
12.96 | LDD0402 | [1] | |
DBIA Probe Info |
![]() |
C61(1.35) | LDD3312 | [2] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0036 | [3] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0372 | CL103 | HEK-293T | C81(0.85) | LDD1576 | [4] |
LDCM0376 | CL107 | HEK-293T | C81(0.79) | LDD1580 | [4] |
LDCM0381 | CL111 | HEK-293T | C81(0.93) | LDD1585 | [4] |
LDCM0385 | CL115 | HEK-293T | C81(0.91) | LDD1589 | [4] |
LDCM0389 | CL119 | HEK-293T | C81(0.85) | LDD1593 | [4] |
LDCM0394 | CL123 | HEK-293T | C81(0.76) | LDD1598 | [4] |
LDCM0398 | CL127 | HEK-293T | C81(0.91) | LDD1602 | [4] |
LDCM0402 | CL15 | HEK-293T | C81(0.74) | LDD1606 | [4] |
LDCM0415 | CL27 | HEK-293T | C81(0.91) | LDD1619 | [4] |
LDCM0418 | CL3 | HEK-293T | C81(0.81) | LDD1622 | [4] |
LDCM0428 | CL39 | HEK-293T | C81(1.01) | LDD1632 | [4] |
LDCM0455 | CL63 | HEK-293T | C81(0.96) | LDD1658 | [4] |
LDCM0481 | CL87 | HEK-293T | C81(1.05) | LDD1684 | [4] |
LDCM0494 | CL99 | HEK-293T | C81(0.86) | LDD1697 | [4] |
LDCM0495 | E2913 | HEK-293T | C81(0.92) | LDD1698 | [4] |
LDCM0468 | Fragment33 | HEK-293T | C81(1.03) | LDD1671 | [4] |
LDCM0022 | KB02 | HEK-293T | C61(0.98) | LDD1492 | [4] |
LDCM0023 | KB03 | HEK-293T | C61(1.12) | LDD1497 | [4] |
LDCM0024 | KB05 | HMCB | C61(1.35) | LDD3312 | [2] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Sodium-dependent organic anion transporter (SLC10A6) | Bile acid:sodium symporter (BASS) family | Q3KNW5 | |||
Protrudin (ZFYVE27) | . | Q5T4F4 |
Cytokine and receptor
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Tumor necrosis factor (TNF) | Tumor necrosis factor family | P01375 |
References