Details of the Target
General Information of Target
Target ID | LDTP08857 | |||||
---|---|---|---|---|---|---|
Target Name | RING1 and YY1-binding protein (RYBP) | |||||
Gene Name | RYBP | |||||
Gene ID | 23429 | |||||
Synonyms |
DEDAF; YEAF1; RING1 and YY1-binding protein; Apoptin-associating protein 1; APAP-1; Death effector domain-associated factor; DED-associated factor; YY1 and E4TF1-associated factor 1 |
|||||
3D Structure | ||||||
Sequence |
MTMGDKKSPTRPKRQAKPAADEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQ
LVAQQVAQQYATPPPPKKEKKEKVEKQDKEKPEKDKEISPSVTKKNTNKKTKPKSDILKD PPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSS STSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF |
|||||
Target Bioclass |
Other
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1-like complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Component of a PRC1-like complex that mediates monoubiquitination of histone H2A 'Lys-119' on the X chromosome and is required for normal silencing of one copy of the X chromosome in XX females. May stimulate ubiquitination of histone H2A 'Lys-119' by recruiting the complex to target sites. Inhibits ubiquitination and subsequent degradation of TP53, and thereby plays a role in regulating transcription of TP53 target genes. May also regulate the ubiquitin-mediated proteasomal degradation of other proteins like FANK1 to regulate apoptosis. May be implicated in the regulation of the transcription as a repressor of the transcriptional activity of E4TF1. May bind to DNA. May play a role in the repression of tumor growth and metastasis in breast cancer by down-regulating SRRM3.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C41(1.48); C44(1.48) | LDD0080 | [1] | |
m-APA Probe Info |
![]() |
N.A. | LDD2234 | [2] |
Competitor(s) Related to This Target
References