Details of the Target
General Information of Target
| Target ID | LDTP08856 | |||||
|---|---|---|---|---|---|---|
| Target Name | Secreted frizzled-related protein 1 (SFRP1) | |||||
| Gene Name | SFRP1 | |||||
| Gene ID | 6422 | |||||
| Synonyms |
FRP; FRP1; SARP2; Secreted frizzled-related protein 1; FRP-1; sFRP-1; Secreted apoptosis-related protein 2; SARP-2 |
|||||
| 3D Structure | ||||||
| Sequence |
MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVD
IPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPV CLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKP QGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKK KDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKK MKNHECPTFQSVFK |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Secreted frizzled-related protein (sFRP) family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP1 decreases intracellular beta-catenin levels. Has antiproliferative effects on vascular cells, in vitro and in vivo, and can induce, in vivo, an angiogenic response. In vascular cell cycle, delays the G1 phase and entry into the S phase. In kidney development, inhibits tubule formation and bud growth in metanephroi. Inhibits WNT1/WNT4-mediated TCF-dependent transcription.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C68(3.34) | LDD3413 | [1] | |
Competitor(s) Related to This Target

