Details of the Target
General Information of Target
| Target ID | LDTP08846 | |||||
|---|---|---|---|---|---|---|
| Target Name | Epidermal retinol dehydrogenase 2 (SDR16C5) | |||||
| Gene Name | SDR16C5 | |||||
| Gene ID | 195814 | |||||
| Synonyms |
RDHE2; Epidermal retinol dehydrogenase 2; EPHD-2; RDH-E2; EC 1.1.1.105; Retinal short-chain dehydrogenase reductase 2; retSDR2; Short-chain dehydrogenase/reductase family 16C member 5 |
|||||
| 3D Structure | ||||||
| Sequence |
MSFNLQSSKKLFIFLGKSLFSLLEAMIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQF
ARLGSVLVLWDINKEGNEETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVS ILINNAGIVTGKKFLDCPDELMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAG LSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKTGMFEGCTTGCPS LLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYLGILHAMD GFVDQKKKL |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Short-chain dehydrogenases/reductases (SDR) family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Oxidoreductase with strong preference for NAD. Active in both the oxidative and reductive directions. Oxidizes all-trans-retinol in all-trans-retinaldehyde. No activity was detected with 11-cis-retinol or 11-cis-retinaldehyde as substrates with either NAD(+)/NADH or NADP(+)/NADPH.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| HT115 | SNV: p.F14V | DBIA Probe Info | |||
| IGR1 | SNV: p.S18L | . | |||
| JHH7 | SNV: p.N4H | . | |||
| K562 | SNV: p.T96P | . | |||
| SH4 | SNV: p.P162L | . | |||
| SNU1 | SNV: p.A25V | . | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C81(1.65); C222(1.04) | LDD3312 | [1] | |
Competitor(s) Related to This Target
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Sorting nexin-1 (SNX1) | Sorting nexin family | Q13596 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Heat shock transcription factor, X-linked (HSFX1; HSFX2) | HSF family | Q9UBD0 | |||
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| FUN14 domain-containing protein 2 (FUNDC2) | FUN14 family | Q9BWH2 | |||
| Synaptotagmin-16 (SYT16) | Synaptotagmin family | Q17RD7 | |||
| Alpha-tocopherol transfer protein (TTPA) | . | P49638 | |||

