Details of the Target

General Information of Target

Target ID LDTP08838
Target Name Beta-taxilin (TXLNB)
Gene Name TXLNB
Gene ID 167838
Synonyms
C6orf198; MDP77; Beta-taxilin; Muscle-derived protein 77; hMDP77
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEANHSEQLSAERQSTPPGDSSSLPSHNGLEKEDGQDSPTPVQPPEKEASVHPDISEELN
RQLEDIINTYGSAASTAGKEGSARASEQPENAESPDNEDGDCEETTEEAGREPVASGEPP
TVKEPVSNKEQKLEKKILKGLGKEANLLMQNLNKLQTPEEKFDFLFKKYAELLDEHRTEQ
KKLKLLQKKQVQIQKEKDQLQGEHSRAILARSKLESLCRELQRHNKTLKEEALQRAREEE
EKRKEITSHFQSTLTDIQGQIEQQSERNMKLCQENTELAEKLKSIIDQYELREEHLDKIF
KHRELQQKLVDAKLEQAQEMMKEAEERHKREKEYLLNQAAEWKLQAKVLKEQETVLQAQL
TLYSGRFEEFQSTLTKSNEVFATFKQEMDKTTKKMKKLEKDTATWKARFENCNKALLDMI
EEKALRAKEYECFVMKIGRLENLCRALQEERNELHKKIRDAEISEKDDQSQHNSDEEPES
NVSVDQEIDAEEVNSVQTAVKNLATAFMIIHHPESTPHQSKETQPEIGSSQESADAALKE
PEQPPLIPSRDSESPLPPLTPQAEAEGGSDAEPPSKASNSPAGLGAETQCEGLPVGAQAD
QASWKPEAEASGQAPQAPTEASLQKMEADVPAPACAAEEHVAAMVPACEPSRQPPRAAAE
ELPVGASAGPQPRNVADTNLEGVD
Target Bioclass
Other
Family
Taxilin family
Function Promotes motor nerve regeneration. May be involved in intracellular vesicle traffic.
Uniprot ID
Q8N3L3
Ensemble ID
ENST00000358430.8
HGNC ID
HGNC:21617

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C432(7.30)  LDD3344  [1]
Acrolein
 Probe Info  		N.A.  LDD0217  [2]
Methacrolein
 Probe Info  		N.A.  LDD0218  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [2]
 LDCM0022  KB02 MGG123 C272(2.11); C80(2.01)  LDD2469  [1]
 LDCM0023  KB03 MGG123 C272(2.77); C80(2.78)  LDD2886  [1]
 LDCM0024  KB05 NCI-H146 C432(7.30)  LDD3344  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transcriptional adapter 3 (TADA3) NGG1 family O75528
Transporter and channel
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
WASH complex subunit 3 (WASHC3) CCDC53 family Q9Y3C0
Leucine zipper putative tumor suppressor 1 (LZTS1) LZTS family Q9Y250
Exocyst complex component 5 (EXOC5) SEC10 family O00471
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 20 (ZNF20) Krueppel C2H2-type zinc-finger protein family P17024
Transcription factor BTF3 (BTF3) NAC-beta family P20290
Transcription factor BTF3 homolog 4 (BTF3L4) NAC-beta family Q96K17
DNA methyltransferase 1-associated protein 1 (DMAP1) . Q9NPF5
Transcription factor SOX-13 (SOX13) . Q9UN79
Other
Click To Hide/Show 51 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Coiled-coil domain-containing protein 88B (CCDC88B) CCDC88 family A6NC98
Cerebellar degeneration-related protein 2 (CDR2) CDR2 family Q01850
Centrosomal protein of 19 kDa (CEP19) CEP19 family Q96LK0
Centrosomal protein of 63 kDa (CEP63) CEP63 family Q96MT8
Deuterosome assembly protein 1 (DEUP1) CEP63 family Q05D60
Cilia- and flagella-associated protein 53 (CFAP53) CFAP53 family Q96M91
Protein chibby homolog 2 (CBY2) Chibby family Q8NA61
DPY30 domain-containing protein 1 (DYDC1) Dpy-30 family Q8WWB3
Dynein regulatory complex subunit 4 (GAS8) DRC4 family O95995
Dynactin subunit 2 (DCTN2) Dynactin subunit 2 family Q13561
Dysbindin (DTNBP1) Dysbindin family Q96EV8
Protein FAM161A (FAM161A) FAM161 family Q3B820
Protein FAM167A (FAM167A) FAM167 (SEC) family Q96KS9
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
HAUS augmin-like complex subunit 3 (HAUS3) HAUS3 family Q68CZ6
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cuticular Ha5 (KRT35) Intermediate filament family Q92764
Keratin, type I cuticular Ha7 (KRT37) Intermediate filament family O76014
Keratin, type I cuticular Ha8 (KRT38) Intermediate filament family O76015
Keratin, type I cytoskeletal 13 (KRT13) Intermediate filament family P13646
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 16 (KRT16) Intermediate filament family P08779
Keratin, type I cytoskeletal 26 (KRT26) Intermediate filament family Q7Z3Y9
Keratin, type I cytoskeletal 27 (KRT27) Intermediate filament family Q7Z3Y8
Keratin, type I cytoskeletal 39 (KRT39) Intermediate filament family Q6A163
Keratin, type II cytoskeletal 6A (KRT6A) Intermediate filament family P02538
Keratin, type II cytoskeletal 75 (KRT75) Intermediate filament family O95678
Vimentin (VIM) Intermediate filament family P08670
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Mediator of RNA polymerase II transcription subunit 4 (MED4) Mediator complex subunit 4 family Q9NPJ6
Meiosis-specific nuclear structural protein 1 (MNS1) MNS1 family Q8NEH6
N-myc-interactor (NMI) NMI family Q13287
Leupaxin (LPXN) Paxillin family O60711
Suppressor of IKBKE 1 (SIKE1) SIKE family Q9BRV8
Stathmin-3 (STMN3) Stathmin family Q9NZ72
Alpha-taxilin (TXLNA) Taxilin family P40222
T-cell leukemia/lymphoma protein 1A (TCL1A) TCL1 family P56279
Centrosomal protein CEP57L1 (CEP57L1) Translokin family Q8IYX8
U3 small nucleolar RNA-associated protein 14 homolog A (UTP14A) UTP14 family Q9BVJ6
Vacuolar protein sorting-associated protein 52 homolog (VPS52) VPS52 family Q8N1B4
Axin-2 (AXIN2) . Q9Y2T1
Cancer-associated gene 1 protein (CAGE1) . Q8TC20
Cancer/testis antigen 55 (CT55) . Q8WUE5
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
Coiled-coil domain-containing protein 13 (CCDC13) . Q8IYE1
Coiled-coil domain-containing protein 152 (CCDC152) . Q4G0S7
Leucine rich adaptor protein 1 (LURAP1) . Q96LR2
Lung adenoma susceptibility protein 2 (LAS2) . Q8IYD9
MAP3K12-binding inhibitory protein 1 (MBIP) . Q9NS73
Outer dynein arm-docking complex subunit 3 (ODAD3) . A5D8V7
Protein hinderin (KIAA1328) . Q86T90

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.