Details of the Target
General Information of Target
| Target ID | LDTP08752 | |||||
|---|---|---|---|---|---|---|
| Target Name | EP300-interacting inhibitor of differentiation 3 (EID3) | |||||
| Gene Name | EID3 | |||||
| Gene ID | 493861 | |||||
| Synonyms |
EP300-interacting inhibitor of differentiation 3; EID-3; E1A-like inhibitor of differentiation 3; EID-1-like inhibitor of differentiation 3; Non-structural maintenance of chromosomes element 4 homolog B; NS4EB; Non-SMC element 4 homolog B
|
|||||
| 3D Structure | ||||||
| Sequence |
MKMDVSVRAAGCSDDLSSGEADVDPKLLELTADEEKCRSIRRQYRQLMYCVRQNREDIVS
SANNSLTEALEEANVLFDGVSRTREAALDARFLVMASDLGKEKAKQLNSDMNFFNQLAFC DFLFLFVGLNWMEGDPDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERS APKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEATEKNVERILGLLQTYFRKYPDTPV SYFEFVIDPNSFSRTVENIFYVSFIVRDGFARIRLDEDRLPILEPMNVNQMGEGNDSSCH GRKQGVISLTLQEWKNIVAAFEISEAMITYSSY |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
NSE4 family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Tissue-specific component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks. The complex is required for telomere maintenance via recombination and mediates sumoylation of shelterin complex (telosome) components.; Acts as a repressor of nuclear receptor-dependent transcription possibly by interfering with CREBBP-dependent coactivation. May function as a coinhibitor of other CREBBP/EP300-dependent transcription factors.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_4 Probe Info |
 |
N.A. | LDD2226 | [1] | |