Details of the Target
General Information of Target
| Target ID | LDTP08750 | |||||
|---|---|---|---|---|---|---|
| Target Name | ORM1-like protein 3 (ORMDL3) | |||||
| Gene Name | ORMDL3 | |||||
| Gene ID | 94103 | |||||
| Synonyms |
ORM1-like protein 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGM
YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD QIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
ORM family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
Plays an essential role in the homeostatic regulation of sphingolipid de novo biosynthesis by modulating the activity of the serine palmitoyltransferase (SPT) in response to ceramide levels. When complexed to SPT, the binding of ceramides to its N-terminus stabilizes a conformation that block SPT substrate entry, hence preventing SPT catalytic activity. Through this mechanism, maintains ceramide levels at sufficient concentrations for the production of complex sphingolipids, but which prevents the accumulation of ceramides to levels that trigger apoptosis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
OPA-S-S-alkyne Probe Info |
![]() |
K79(5.16) | LDD3494 | [1] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [2] | |
|
STPyne Probe Info |
![]() |
N.A. | LDD0009 | [3] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Transporter and channel
GPCR
Other
References



