Details of the Target

General Information of Target

Target ID LDTP08750
Target Name ORM1-like protein 3 (ORMDL3)
Gene Name ORMDL3
Gene ID 94103
Synonyms
ORM1-like protein 3
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGM
YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD
QIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY
Target Bioclass
Other
Family
ORM family
Subcellular location
Endoplasmic reticulum membrane
Function
Plays an essential role in the homeostatic regulation of sphingolipid de novo biosynthesis by modulating the activity of the serine palmitoyltransferase (SPT) in response to ceramide levels. When complexed to SPT, the binding of ceramides to its N-terminus stabilizes a conformation that block SPT substrate entry, hence preventing SPT catalytic activity. Through this mechanism, maintains ceramide levels at sufficient concentrations for the production of complex sphingolipids, but which prevents the accumulation of ceramides to levels that trigger apoptosis.
Uniprot ID
Q8N138
Ensemble ID
ENST00000304046.7
HGNC ID
HGNC:16038

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
HCT15 SNV: p.R20C .
MEWO SNV: p.P41S .
T98G SNV: p.S133I .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 3 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
OPA-S-S-alkyne
 Probe Info  		K79(5.16)  LDD3494  [1]
ATP probe
 Probe Info  		N.A.  LDD0199  [2]
STPyne
 Probe Info  		N.A.  LDD0009  [3]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Serine palmitoyltransferase 1 (SPTLC1) Class-II pyridoxal-phosphate-dependent aminotransferase family O15269
3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase (EBP) EBP family Q15125
Very long chain fatty acid elongase 4 (ELOVL4) ELO family Q9GZR5
Atypical kinase COQ8A, mitochondrial (COQ8A) ADCK protein kinase family Q8NI60
E3 ubiquitin-protein ligase RNF5 (RNF5) RNF5 family Q99942
17-beta-hydroxysteroid dehydrogenase 13 (HSD17B13) Short-chain dehydrogenases/reductases (SDR) family Q7Z5P4
ADP-ribosylation factor-like protein 13B (ARL13B) Arf family Q3SXY8
Ceramide synthase 3 (CERS3) . Q8IU89
Transporter and channel
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
High affinity cationic amino acid transporter 1 (SLC7A1) Cationic amino acid transporter (CAT) (TC 2.A.3.3) family P30825
Hepatic sodium/bile acid cotransporter (SLC10A1) Bile acid:sodium symporter (BASS) family Q14973
Aquaporin-6 (AQP6) MIP/aquaporin (TC 1.A.8) family Q13520
Potassium channel subfamily K member 5 (KCNK5) Two pore domain potassium channel (TC 1.A.1.8) family O95279
Guided entry of tail-anchored proteins factor 1 (GET1) WRB/GET1 family O00258
GPCR
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Probable G-protein coupled receptor 101 (GPR101) G-protein coupled receptor 1 family Q96P66
Probable G-protein coupled receptor 152 (GPR152) G-protein coupled receptor 1 family Q8TDT2
Other
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Receptor expression-enhancing protein 2 (REEP2) DP1 family Q9BRK0
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein FAM209A (FAM209A) FAM209 family Q5JX71
Translation initiation factor IF-3, mitochondrial (MTIF3) IF-3 family Q9H2K0
Leptin receptor overlapping transcript-like 1 (LEPROTL1) OB-RGRP/VPS55 family O95214
Rod outer segment membrane protein 1 (ROM1) PRPH2/ROM1 family Q03395
Reticulophagy regulator 3 (RETREG3) RETREG family Q86VR2
Synaptotagmin-2 (SYT2) Synaptotagmin family Q8N9I0

References

1 A chemical proteomics approach for global mapping of functional lysines on cell surface of living cell. Nat Commun. 2024 Apr 8;15(1):2997. doi: 10.1038/s41467-024-47033-w.
Mass spectrometry data entry: PXD042888
2 Targeted Proteomic Approaches for Proteome-Wide Characterizations of the AMP-Binding Capacities of Kinases. J Proteome Res. 2022 Aug 5;21(8):2063-2070. doi: 10.1021/acs.jproteome.2c00225. Epub 2022 Jul 12.
3 A modification-centric assessment tool for the performance of chemoproteomic probes. Nat Chem Biol. 2022 Aug;18(8):904-912. doi: 10.1038/s41589-022-01074-8. Epub 2022 Jul 21.
Mass spectrometry data entry: PXD027758 , PXD027755 , PXD027760 , PXD027762 , PXD027756 , PXD027591 , PXD007149 , PXD030064 , PXD032392 , PXD027789 , PXD027767 , PXD027764