Details of the Target
General Information of Target
| Target ID | LDTP08674 | |||||
|---|---|---|---|---|---|---|
| Target Name | Izumo sperm-egg fusion protein 1 (IZUMO1) | |||||
| Gene Name | IZUMO1 | |||||
| Gene ID | 284359 | |||||
| Synonyms |
Izumo sperm-egg fusion protein 1; Oocyte binding/fusion factor; OBF; Sperm-specific protein izumo |
|||||
| 3D Structure | ||||||
| Sequence |
MGPHFTLLCAALAGCLLPAEGCVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENA
VKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKE TFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMIL DCELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNS SPATIINFHVTVLPKMIKEEKPSPNIVTPGEATTESSISLQPLQPEKMLASRLLGLLICG SLALITGLTFAIFRRRKVIDFIKSSLFGLGSGAAEQTQVPKEKATDSRQQ |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Izumo family
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Essential sperm cell-surface protein required for fertilization by acting as a ligand for IZUMO1R/JUNO receptor on egg. The IZUMO1:IZUMO1R/JUNO interaction is a necessary adhesion event between sperm and egg that is required for fertilization but is not sufficient for cell fusion. The ligand-receptor interaction probably does not act as a membrane 'fusogen'. Acts a ligand for the human-specific oolemma epitope FCRL3/MAIA during fertilization. FCRL3/MAIA replaces IZUMO1R/JUNO as IZUMO1 receptor after sperm-egg adhesion, which permits species-specific gamete fusion.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BTD Probe Info |
![]() |
C159(0.85) | LDD2136 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0166 | [2] | |
Competitor(s) Related to This Target
References


