Details of the Target

General Information of Target

Target ID LDTP08622
Target Name Intraflagellar transport protein 20 homolog (IFT20)
Gene Name IFT20
Gene ID 90410
Synonyms
Intraflagellar transport protein 20 homolog; hIFT20
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAKDILGEAGLHFDELNKLRVLDPEVTQQTIELKEECKDFVDKIGQFQKIVGGLIELVDQ
LAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAE
QNEFIDQFIFQK
Target Bioclass
Other
Subcellular location
Golgi apparatus, cis-Golgi network
Function
Part of intraflagellar transport (IFT) particles involved in ciliary process assembly. May play a role in the trafficking of ciliary membrane proteins from the Golgi complex to the cilium. Regulates the platelet-derived growth factor receptor-alpha (PDGFRA) signaling pathway. Required for protein stability of E3 ubiquitin ligases CBL and CBLB that mediate ubiquitination and internalization of PDGFRA for proper feedback inhibition of PDGFRA signaling. Essential for male fertility. Plays an important role in spermatogenesis, particularly spermiogenesis, when germ cells form flagella. May play a role in the transport of flagellar proteins ODF2 and SPAG16 to build sperm flagella and in the removal of redundant sperm cytoplasm. Also involved in autophagy since it is required for trafficking of ATG16L and the expansion of the autophagic compartment.
Uniprot ID
Q8IY31
Ensemble ID
ENST00000357896.7
HGNC ID
HGNC:30989

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
G402 SNV: p.I31L .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 4 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
STPyne
 Probe Info  		K100(4.30)  LDD0277  [1]
m-APA
 Probe Info  		14.27  LDD0403  [2]
IPM
 Probe Info  		N.A.  LDD2156  [3]
AOyne
 Probe Info  		15.00  LDD0443  [4]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0156  Aniline NCI-H1299 14.27  LDD0403  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 10 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Peroxisomal ATPase PEX1 (PEX1) AAA ATPase family O43933
Palmitoyltransferase ZDHHC17 (ZDHHC17) DHHC palmitoyltransferase family Q8IUH5
Histone acetyltransferase KAT5 (KAT5) MYST (SAS/MOZ) family Q92993
Serine protease HTRA2, mitochondrial (HTRA2) Peptidase S1C family O43464
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Fibroblast growth factor receptor 3 (FGFR3) Tyr protein kinase family P22607
GTPase HRas (HRAS) Ras family P01112
E3 ubiquitin-protein ligase PPP1R11 (PPP1R11) . O60927
Fibronectin type III and SPRY domain-containing protein 2 (FSD2) . A1L4K1
Oxidoreductase NAD-binding domain-containing protein 1 (OXNAD1) . Q96HP4
Transporter and channel
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Battenin (CLN3) Battenin family Q13286
WASH complex subunit 3 (WASHC3) CCDC53 family Q9Y3C0
Exocyst complex component 7 (EXOC7) EXO70 family Q9UPT5
mRNA export factor GLE1 (GLE1) GLE1 family Q53GS7
Huntingtin (HTT) Huntingtin family P42858
Aquaporin-1 (AQP1) MIP/aquaporin (TC 1.A.8) family P29972
Nuclear pore glycoprotein p62 (NUP62) Nucleoporin NSP1/NUP62 family P37198
Nucleoporin p54 (NUP54) NUP54 family Q7Z3B4
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
C-type lectin domain family 4 member M (CLEC4M) . Q9H2X3
Wolframin (WFS1) . O76024
Transcription factor
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
Pre-B-cell leukemia transcription factor 4 (PBX4) TALE/PBX homeobox family Q9BYU1
Other
Click To Hide/Show 29 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ABI gene family member 3 (ABI3) ABI family Q9P2A4
Abl interactor 2 (ABI2) ABI family Q9NYB9
Ataxin-1 (ATXN1) ATXN1 family P54253
Biogenesis of lysosome-related organelles complex 1 subunit 6 (BLOC1S6) BLOC1S6 family Q9UL45
Protein BRICK1 (BRK1) BRK1 family Q8WUW1
Deuterosome assembly protein 1 (DEUP1) CEP63 family Q05D60
Dysbindin (DTNBP1) Dysbindin family Q96EV8
Protein FAM81B (FAM81B) FAM81 family Q96LP2
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
HAUS augmin-like complex subunit 1 (HAUS1) HAUS1 family Q96CS2
Intraflagellar transport protein 57 homolog (IFT57) IFT57 family Q9NWB7
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Peripherin (PRPH) Intermediate filament family P41219
KxDL motif-containing protein 1 (KXD1) KXD1 family Q9BQD3
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Mediator of RNA polymerase II transcription subunit 30 (MED30) Mediator complex subunit 30 family Q96HR3
Mediator of RNA polymerase II transcription subunit 4 (MED4) Mediator complex subunit 4 family Q9NPJ6
Protein Mis18-alpha (MIS18A) Mis18 family Q9NYP9
Kinetochore protein NDC80 homolog (NDC80) NDC80/HEC1 family O14777
Putative ciliary rootlet coiled-coil protein-like 1 protein (CROCCP2) Rootletin family Q86T23
SH3 domain-binding protein 5 (SH3BP5) SH3BP5 family O60239
Synaptonemal complex central element protein 2 (SYCE2) SYCE family Q6PIF2
UPF0500 protein C1orf216 (C1orf216) UPF0500 family Q8TAB5
Gelsolin (GSN) Villin/gelsolin family P06396
Coronin-1A (CORO1A) WD repeat coronin family P31146
EMILIN-1 (EMILIN1) . Q9Y6C2
Ras association domain-containing protein 4 (RASSF4) . Q9H2L5
Small kinetochore-associated protein (KNSTRN) . Q9Y448
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699

References

1 A Paal-Knorr agent for chemoproteomic profiling of targets of isoketals in cells. Chem Sci. 2021 Oct 15;12(43):14557-14563. doi: 10.1039/d1sc02230j. eCollection 2021 Nov 10.
Mass spectrometry data entry: PXD028270
2 Quantitative and Site-Specific Chemoproteomic Profiling of Targets of Acrolein. Chem Res Toxicol. 2019 Mar 18;32(3):467-473. doi: 10.1021/acs.chemrestox.8b00343. Epub 2019 Jan 15.
3 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
4 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.