Details of the Target

General Information of Target

Target ID LDTP08575
Target Name Tripartite motif-containing protein 42 (TRIM42)
Gene Name TRIM42
Gene ID 287015
Synonyms
Tripartite motif-containing protein 42
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
METAMCVCCPCCTWQRCCPQLCSCLCCKFIFTSERNCTCFPCPYKDERNCQFCHCTCSES
PNCHWCCCSWANDPNCKCCCTASSNLNCYYYESRCCRNTIITFHKGRLRSIHTSSKTALR
TGSSDTQVDEVKSIPANSHLVNHLNCPMCSRLRLHSFMLPCNHSLCEKCLRQLQKHAEVT
ENFFILICPVCDRSHCMPYSNKMQLPENYLHGRLTKRYMQEHGYLKWRFDRSSGPILCQV
CRNKRIAYKRCITCRLNLCNDCLKAFHSDVAMQDHVFVDTSAEEQDEKICIHHPSSRIIE
YCRNDNKLLCTFCKFSFHNGHDTISLIDACSERAASLFSAIAKFKAVRYEIDNDLMEFNI
LKNSFKADKEAKRKEIRNGFLKLRSILQEKEKIIMEQIENLEVSRQKEIEKYVYVTTMKV
NEMDGLIAYSKEALKETGQVAFLQSAKILVDQIEDGIQTTYRPDPQLRLHSINYVPLDFV
ELSSAIHELFPTGPKKVRSSGDSLPSPYPVHSETMIARKVTFSTHSLGNQHIYQRSSSML
SFSNTDKKAKVGLEACGRAQSATPAKPTDGLYTYWSAGADSQSVQNSSSFHNWYSFNDGS
VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEVITSPPNNVQMELCGQIRDIM
QQNLELHNLTPNTEYVFKVRAINDNGPGQWSDICKVVTPDGHGKNRAKWGLLKNIQSALQ
KHF
Target Bioclass
Enzyme
Family
TRIM/RBCC family
Uniprot ID
Q8IWZ5
Ensemble ID
ENST00000286349.4
HGNC ID
HGNC:19014

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
786O SNV: p.V131L .
ABC1 SNV: p.H139P .
AN3CA SNV: p.T417A; p.T459A .
DU145 SNV: p.Q20K .
HCT116 SNV: p.N363D .
HT115 SNV: p.F637L .
HUH1 SNV: p.M1? .
IGR1 SNV: p.E408K .
IGROV1 SNV: p.Y615C .
Ishikawa (Heraklio) 02 ER SNV: p.N208S .
KYSE150 SNV: p.Q611H .
LOXIMVI SNV: p.E408K .
LS180 SNV: p.H163R; p.R193L .
MCC13 SNV: p.W690Ter .
MFE296 SNV: p.K249N .
NCIH446 SNV: p.Q20H .
NCIN87 SNV: p.I607L .
RL952 SNV: p.T113A .
SW403 SNV: p.S114C .
TE11 SNV: p.A346E .
TFK1 SNV: p.C254R .
U2OS SNV: p.D125Y .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
IA-alkyne
 Probe Info  		N.A.  LDD0175  [1]
4-Iodoacetamidophenylacetylene
 Probe Info  		N.A.  LDD0038  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 15 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
3 beta-hydroxysteroid dehydrogenase type 7 (HSD3B7) 3-beta-HSD family Q9H2F3
5'-AMP-activated protein kinase subunit beta-2 (PRKAB2) 5'-AMP-activated protein kinase beta subunit family O43741
Glycerate kinase (GLYCTK) Glycerate kinase type-2 family Q8IVS8
Proteasome subunit alpha type-1 (PSMA1) Peptidase T1A family P25786
Phospholipid scramblase 1 (PLSCR1) Phospholipid scramblase family O15162
26S proteasome non-ATPase regulatory subunit 9 (PSMD9) Proteasome subunit p27 family O00233
Serine/threonine-protein kinase Nek8 (NEK8) NEK Ser/Thr protein kinase family Q86SG6
Serine/threonine-protein kinase 16 (STK16) Ser/Thr protein kinase family O75716
E3 ubiquitin-protein ligase TRIM23 (TRIM23) Arf family P36406
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
Ceramide kinase (CERK) . Q8TCT0
E3 ubiquitin-protein ligase LNX (LNX1) . Q8TBB1
Glutaredoxin-3 (GLRX3) . O76003
LON peptidase N-terminal domain and RING finger protein 1 (LONRF1) . Q17RB8
Transporter and channel
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
14-3-3 protein theta (YWHAQ) 14-3-3 family P27348
Arrestin domain-containing protein 3 (ARRDC3) Arrestin family Q96B67
Cation channel sperm-associated protein 1 (CATSPER1) Cation channel sperm-associated (TC 1.A.1.19) family Q8NEC5
Transmembrane protein 150A (TMEM150A) DRAM/TMEM150 family Q86TG1
Aquaporin-1 (AQP1) MIP/aquaporin (TC 1.A.8) family P29972
Phospholipid scramblase 4 (PLSCR4) Phospholipid scramblase family Q9NRQ2
Protein YIPF3 (YIPF3) YIP1 family Q9GZM5
Slit homolog 1 protein (SLIT1) . O75093
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 16 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Homeobox protein Hox-C8 (HOXC8) Antp homeobox family P31273
Homeobox protein Hox-A1 (HOXA1) Antp homeobox family P49639
Transcription factor AP-2-delta (TFAP2D) AP-2 family Q7Z6R9
Transcription regulator protein BACH2 (BACH2) BZIP family Q9BYV9
REST corepressor 3 (RCOR3) CoREST family Q9P2K3
Zinc finger protein GLI1 (GLI1) GLI C2H2-type zinc-finger protein family P08151
Zinc finger protein Aiolos (IKZF3) Ikaros C2H2-type zinc-finger protein family Q9UKT9
Zinc finger protein 414 (ZNF414) Krueppel C2H2-type zinc-finger protein family Q96IQ9
Homeobox protein prophet of Pit-1 (PROP1) Paired homeobox family O75360
Homeobox protein OTX1 (OTX1) Paired homeobox family P32242
POU domain, class 4, transcription factor 2 (POU4F2) POU transcription factor family Q12837
SWI/SNF complex subunit SMARCC1 (SMARCC1) SMARCC family Q92922
Transcriptional repressor protein YY1 (YY1) YY transcription factor family P25490
Homeobox protein MOX-2 (MEOX2) . P50222
T-cell leukemia homeobox protein 3 (TLX3) . O43711
Zinc finger and BTB domain-containing protein 1 (ZBTB1) . Q9Y2K1
Other
Click To Hide/Show 73 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Afadin- and alpha-actinin-binding protein (SSX2IP) ADIP family Q9Y2D8
Protein BEX2 (BEX2) BEX family Q9BXY8
Protein chibby homolog 2 (CBY2) Chibby family Q8NA61
Chordin (CHRD) Chordin family Q9H2X0
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Protein FAM90A1 (FAM90A1) FAM90 family Q86YD7
EGF-containing fibulin-like extracellular matrix protein 2 (EFEMP2) Fibulin family O95967
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Keratin, type I cuticular Ha4 (KRT34) Intermediate filament family O76011
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Keratin-associated protein 10-5 (KRTAP10-5) KRTAP type 10 family P60370
Keratin-associated protein 10-7 (KRTAP10-7) KRTAP type 10 family P60409
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 10-9 (KRTAP10-9) KRTAP type 10 family P60411
Keratin-associated protein 12-2 (KRTAP12-2) KRTAP type 12 family P59991
Keratin-associated protein 2-4 (KRTAP2-4) KRTAP type 2 family Q9BYR9
Keratin-associated protein 3-2 (KRTAP3-2) KRTAP type 3 family Q9BYR7
Keratin-associated protein 4-2 (KRTAP4-2) KRTAP type 4 family Q9BYR5
Keratin-associated protein 4-4 (KRTAP4-4) KRTAP type 4 family Q9BYR3
Keratin-associated protein 4-5 (KRTAP4-5) KRTAP type 4 family Q9BYR2
Keratin-associated protein 5-11 (KRTAP5-11) KRTAP type 5 family Q6L8G4
Keratin-associated protein 5-7 (KRTAP5-7) KRTAP type 5 family Q6L8G8
Keratin-associated protein 9-3 (KRTAP9-3) KRTAP type 9 family Q9BYQ3
Late cornified envelope protein 1A (LCE1A) LCE family Q5T7P2
Late cornified envelope protein 1B (LCE1B) LCE family Q5T7P3
Late cornified envelope protein 1C (LCE1C) LCE family Q5T751
Late cornified envelope protein 1D (LCE1D) LCE family Q5T752
Late cornified envelope protein 1E (LCE1E) LCE family Q5T753
Late cornified envelope protein 1F (LCE1F) LCE family Q5T754
Late cornified envelope protein 2A (LCE2A) LCE family Q5TA79
Late cornified envelope protein 2B (LCE2B) LCE family O14633
Late cornified envelope protein 2C (LCE2C) LCE family Q5TA81
Late cornified envelope protein 2D (LCE2D) LCE family Q5TA82
Late cornified envelope protein 3A (LCE3A) LCE family Q5TA76
Late cornified envelope protein 3C (LCE3C) LCE family Q5T5A8
Late cornified envelope protein 3D (LCE3D) LCE family Q9BYE3
Late cornified envelope protein 3E (LCE3E) LCE family Q5T5B0
Late cornified envelope protein 4A (LCE4A) LCE family Q5TA78
Late cornified envelope protein 5A (LCE5A) LCE family Q5TCM9
Leucine zipper putative tumor suppressor 2 (LZTS2) LZTS2 family Q9BRK4
Protein mago nashi homolog 2 (MAGOHB) Mago nashi family Q96A72
Microfibrillar-associated protein 1 (MFAP1) MFAP1 family P55081
Microtubule-associated tumor suppressor candidate 2 (MTUS2) MTUS1 family Q5JR59
Zinc finger protein 330 (ZNF330) NOA36 family Q9Y3S2
Notch homolog 2 N-terminal-like protein A (NOTCH2NLA) NOTCH family Q7Z3S9
Notch homolog 2 N-terminal-like protein C (NOTCH2NLC) NOTCH family P0DPK4
Keratin-associated protein 26-1 (KRTAP26-1) PMG family Q6PEX3
Paraneoplastic antigen Ma1 (PNMA1) PNMA family Q8ND90
RNA guanine-N7 methyltransferase activating subunit (RAMAC) RAM family Q9BTL3
Trafficking protein particle complex subunit 2 (TRAPPC2) TRAPP small subunits family P0DI81
AFG2-interacting ribosome maturation factor (AIRIM) . Q9NX04
Armadillo repeat-containing protein 7 (ARMC7) . Q9H6L4
BTB/POZ domain-containing protein KCTD9 (KCTD9) . Q7L273
Caspase recruitment domain-containing protein 9 (CARD9) . Q9H257
Cell division cycle-associated 7-like protein (CDCA7L) . Q96GN5
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
Coiled-coil domain-containing protein 120 (CCDC120) . Q96HB5
Coiled-coil domain-containing protein 24 (CCDC24) . Q8N4L8
Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 (CHCHD2) . Q9Y6H1
EF-hand domain-containing family member C2 (EFHC2) . Q5JST6
Emerin (EMD) . P50402
Interactor of HORMAD1 protein 1 (IHO1) . Q8IYA8
IQ motif and ubiquitin-like domain-containing protein (IQUB) . Q8NA54
Kelch-like protein 38 (KLHL38) . Q2WGJ6
Keratinocyte proline-rich protein (KPRP) . Q5T749
Lethal(3)malignant brain tumor-like protein 2 (L3MBTL2) . Q969R5
Mitogen-activated protein kinase-binding protein 1 (MAPKBP1) . O60336
R3H domain-containing protein 2 (R3HDM2) . Q9Y2K5
Sperm mitochondrial-associated cysteine-rich protein (SMCP) . P49901
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699
TNF receptor-associated factor 1 (TRAF1) . Q13077
von Willebrand factor C domain-containing protein 2-like (VWC2L) . B2RUY7

References

1 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
2 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853