Details of the Target
General Information of Target
| Target ID | LDTP08574 | |||||
|---|---|---|---|---|---|---|
| Target Name | E3 ubiquitin-protein ligase TRIM48 (TRIM48) | |||||
| Gene Name | TRIM48 | |||||
| Gene ID | 79097 | |||||
| Synonyms |
RNF101; E3 ubiquitin-protein ligase TRIM48; EC 2.3.2.27; RING finger protein 101; Tripartite motif-containing protein 48 |
|||||
| 3D Structure | ||||||
| Sequence |
MSRRIIVGTLQRTQRNMNSGISQVFQRELTCPICMNYFIDPVTIDCGHSFCRPCFYLNWQ
DIPILTQCFECIKTIQQRNLKTNIRLKKMASLARKASLWLFLSSEEQMCGIHRETKKMFC EVDRSLLCLLCSSSQEHRYHRHCPAEWAAEEHWEKLLKKMQSLWEKACENQRNLNVETTR ISHWKAFGDILYRSESVLLHMPQPLNLALRAGPITGLRDRLNQF |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
TRIM/RBCC family
|
|||||
| Subcellular location |
Cytoplasm, cytosol
|
|||||
| Function |
E3 ubiquitin-protein ligase which promotes K48-linked polyubiquitination of protein methyltransferase PRMT1, leading to PRMT1 degradation. This suppresses methylation of the PRMT1 substrate MAP3K5/ASK1, promoting its activation and increasing MAP3K5-dependent cell death induced by oxidative stress. TRIM48-mediated ubiquitination of PRMT1 also suppresses methylation of FOXO1 by PRMT1, leading to inhibition of FOXO1 transcriptional activity.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C152(3.43) | LDD3434 | [1] | |
Competitor(s) Related to This Target

