Details of the Target
General Information of Target
| Target ID | LDTP08478 | |||||
|---|---|---|---|---|---|---|
| Target Name | Purine nucleoside phosphorylase LACC1 (LACC1) | |||||
| Gene Name | LACC1 | |||||
| Gene ID | 144811 | |||||
| Synonyms |
C13orf31; FAMIN; Purine nucleoside phosphorylase LACC1; EC 2.4.2.1; Adenosine deaminase LACC1; EC 3.5.4.4; Fatty acid metabolism-immunity nexus; Guanosine phosphorylase LACC1; Laccase domain-containing protein 1; S-methyl-5'-thioadenosine phosphorylase LACC1; EC 2.4.2.28
|
|||||
| 3D Structure | ||||||
| Sequence |
MAEAVLIDLFGLKLNSQKNCHQTLLKTLNAVQYHHAAKAKFLCIMCCSNISYERDGEQDN
CEIETSNGLSALLEEFEIVSCPSMAATLYTIKQKIDEKNLSSIKVIVPRHRKTLMKAFID QLFTDVYNFEFEDLQVTFRGGLFKQSIEINVITAQELRGIQNEIETFLRSLPALRGKLTI ITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQENLRRLANAAGFNV EKFYRIKTHHSNDIWIMGRKEPDSYDGITTNQRGVTIAALGADCIPIVFADPVKKACGVA HAGWKGTLLGVAMATVNAMIAEYGCSLEDIVVVLGPSVGPCCFTLPRESAEAFHNLHPAC VQLFDSPNPCIDIRKATRILLEQGGILPQNIQDQNQDLNLCTSCHPDKFFSHVRDGLNFG TQIGFISIKE |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Purine nucleoside phosphorylase YfiH/LACC1 family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function |
Purine nucleoside enzyme that catalyzes the phosphorolysis of adenosine, guanosine and inosine nucleosides, yielding D-ribose 1-phosphate and the respective free bases, adenine, guanine and hypoxanthine. Also catalyzes the phosphorolysis of S-methyl-5'-thioadenosine into adenine and S-methyl-5-thio-alpha-D-ribose 1-phosphate. Also has adenosine deaminase activity. Acts as a regulator of innate immunity in macrophages by modulating the purine nucleotide metabolism, thereby regulating the metabolic function and bioenergetic state of macrophages. Enables a purine nucleotide cycle between adenosine and inosine monophosphate and adenylosuccinate that prevents cytoplasmic acidification and balances the cytoplasmic-mitochondrial redox interface. The purine nucleotide cycle consumes aspartate and releases fumarate in a manner involving fatty acid oxidation and ATP-citrate lyase activity. Participates in pattern recognition receptor (PRR)-induced cytokines in macrophages: associates with the NOD2-signaling complex and promotes optimal NOD2-induced signaling, cytokine secretion and bacterial clearance. Localizes to the endoplasmic reticulum upon PRR stimulation of macrophages and associates with endoplasmic reticulum-stress sensors, promoting the endoplasmic reticulum unfolded protein response (UPR). Does not show laccase activity.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C284(1.35) | LDD3410 | [1] | |
|
IPM Probe Info |
![]() |
C20(0.97) | LDD1701 | [2] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [3] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C20(1.82) | LDD2187 | [4] |
| LDCM0576 | Fragment14 | Ramos | C20(0.61) | LDD2193 | [4] |
| LDCM0580 | Fragment21 | Ramos | C20(1.62) | LDD2195 | [4] |
| LDCM0582 | Fragment23 | Ramos | C20(0.89) | LDD2196 | [4] |
| LDCM0586 | Fragment28 | Ramos | C20(0.84) | LDD2198 | [4] |
| LDCM0588 | Fragment30 | Ramos | C20(1.84) | LDD2199 | [4] |
| LDCM0614 | Fragment56 | Ramos | C20(0.94) | LDD2205 | [4] |
| LDCM0022 | KB02 | T cell | C284(8.78) | LDD1703 | [5] |
| LDCM0023 | KB03 | MDA-MB-231 | C20(0.97) | LDD1701 | [2] |
| LDCM0024 | KB05 | RPMI-7951 | C284(1.35) | LDD3410 | [1] |
The Interaction Atlas With This Target
References



