Details of the Target
General Information of Target
Target ID | LDTP08417 | |||||
---|---|---|---|---|---|---|
Target Name | Junctional adhesion molecule-like (JAML) | |||||
Gene Name | JAML | |||||
Gene ID | 120425 | |||||
Synonyms |
AMICA1; Junctional adhesion molecule-like; Adhesion molecule interacting with CXADR antigen 1; Dendritic cell-specific protein CREA7-1 |
|||||
3D Structure | ||||||
Sequence |
MFCPLKLILLPVLLDYSLGLNDLNVSPPELTVHVGDSALMGCVFQSTEDKCIFKIDWTLS
PGEHAKDEYVLYYYSNLSVPIGRFQNRVHLMGDILCNDGSLLLQDVQEADQGTYICEIRL KGESQVFKKAVVLHVLPEEPKELMVHVGGLIQMGCVFQSTEVKHVTKVEWIFSGRRAKEE IVFRYYHKLRMSVEYSQSWGHFQNRVNLVGDIFRNDGSIMLQGVRESDGGNYTCSIHLGN LVFKKTIVLHVSPEEPRTLVTPAALRPLVLGGNQLVIIVGIVCATILLLPVLILIVKKTC GNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEEEEPSEKSEAT YMTMHPVWPSLRSDRNNSLEKKSGGGMPKTQQAF |
|||||
Target Bioclass |
Immunoglobulin
|
|||||
Family |
Immunoglobulin superfamily
|
|||||
Subcellular location |
Cell membrane
|
|||||
Function |
Transmembrane protein of the plasma membrane of leukocytes that control their migration and activation through interaction with CXADR, a plasma membrane receptor found on adjacent epithelial and endothelial cells. The interaction between both receptors mediates the activation of gamma-delta T-cells, a subpopulation of T-cells residing in epithelia and involved in tissue homeostasis and repair. Upon epithelial CXADR-binding, JAML induces downstream cell signaling events in gamma-delta T-cells through PI3-kinase and MAP kinases. It results in proliferation and production of cytokines and growth factors by T-cells that in turn stimulate epithelial tissues repair. It also controls the transmigration of leukocytes within epithelial and endothelial tissues through adhesive interactions with epithelial and endothelial CXADR.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C327(2.70) | LDD2324 | [1] |
Competitor(s) Related to This Target