Details of the Target
General Information of Target
| Target ID | LDTP08388 | |||||
|---|---|---|---|---|---|---|
| Target Name | Ly6/PLAUR domain-containing protein 6 (LYPD6) | |||||
| Gene Name | LYPD6 | |||||
| Gene ID | 130574 | |||||
| Synonyms |
Ly6/PLAUR domain-containing protein 6 |
|||||
| 3D Structure | ||||||
| Sequence |
MEPGPALAWLLLLSLLADCLKAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYE
CNRWAPDIYCPRETRYCYTQHTMEVTGNSISVTKRCVPLEECLSTGCRDSEHEGHKVCTS CCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMSVIVSCLWLWLGLML |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Acts as a modulator of nicotinic acetylcholine receptors (nAChRs) function in the brain. Inhibits nicotine-induced Ca(2+) influx through nAChRs. In vitro, specifically inhibits alpha-3:beta-4 and alpha-7 nAChR currents in an allosteric manner. Acts as a positive regulator of Wnt/beta-catenin signaling.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
W1 Probe Info |
![]() |
N.A. | LDD0236 | [1] | |
|
NAIA_5 Probe Info |
![]() |
N.A. | LDD2223 | [2] | |
The Interaction Atlas With This Target
References


