Details of the Target
General Information of Target
| Target ID | LDTP08374 | |||||
|---|---|---|---|---|---|---|
| Target Name | Vacuolar protein sorting-associated protein 37D (VPS37D) | |||||
| Gene Name | VPS37D | |||||
| Gene ID | 155382 | |||||
| Synonyms |
WBSCR24; Vacuolar protein sorting-associated protein 37D; ESCRT-I complex subunit VPS37D; Williams-Beuren syndrome chromosomal region 24 protein |
|||||
| 3D Structure | ||||||
| Sequence |
MYRARAARAGPEPGSPGRFGILSTGQLRDLLQDEPKLDRIVRLSRKFQGLQLEREACLAS
NYALAKENLALRPRLEMGRAALAIKYQELREVAENCADKLQRLEESMHRWSPHCALGWLQ AELEEAEQEAEEQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAEKLQELLRRRERSAQ PAPTSAADPPKSFPAAAVLPTGAARGPPAVPRSLPPLDSRPVPPLKGSPGCPLGPAPLLS PRPSQPEPPHR |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
VPS37 family
|
|||||
| Subcellular location |
Late endosome membrane
|
|||||
| Function |
Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
 |
N.A. | LDD2156 | [1] | |
The Interaction Atlas With This Target