Details of the Target
General Information of Target
| Target ID | LDTP08310 | |||||
|---|---|---|---|---|---|---|
| Target Name | Phosphatidylcholine:ceramide cholinephosphotransferase 1 (SGMS1) | |||||
| Gene Name | SGMS1 | |||||
| Gene ID | 259230 | |||||
| Synonyms |
MOB; SMS1; TMEM23; Phosphatidylcholine:ceramide cholinephosphotransferase 1; EC 2.7.8.27; Medulla oblongata-derived protein; Protein Mob; Sphingomyelin synthase 1; Transmembrane protein 23 |
|||||
| 3D Structure | ||||||
| Sequence |
MKEVVYWSPKKVADWLLENAMPEYCEPLEHFTGQDLINLTQEDFKKPPLCRVSSDNGQRL
LDMIETLKMEHHLEAHKNGHANGHLNIGVDIPTPDGSFSIKIKPNGMPNGYRKEMIKIPM PELERSQYPMEWGKTFLAFLYALSCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRV QWAFSICEINGMILVGLWLIQWLLLKYKSIISRRFFCIVGTLYLYRCITMYVTTLPVPGM HFNCSPKLFGDWEAQLRRIMKLIAGGGLSITGSHNMCGDYLYSGHTVMLTLTYLFIKEYS PRRLWWYHWICWLLSVVGIFCILLAHDHYTVDVVVAYYITTRLFWWYHTMANQQVLKEAS QMNLLARVWWYRPFQYFEKNVQGIVPRSYHWPFPWPVVHLSRQVKYSRLVNDT |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Sphingomyelin synthase family
|
|||||
| Subcellular location |
Golgi apparatus membrane
|
|||||
| Function |
Major sphingomyelin synthase at the Golgi apparatus. Catalyzes the reversible transfer of phosphocholine moiety in sphingomyelin biosynthesis: in the forward reaction transfers phosphocholine head group of phosphatidylcholine (PC) on to ceramide (CER) to form ceramide phosphocholine (sphingomyelin, SM) and diacylglycerol (DAG) as by-product, and in the reverse reaction transfers phosphocholine from SM to DAG to form PC and CER. The direction of the reaction depends on the levels of CER and DAG in Golgi membranes. Does not use free phosphorylcholine or CDP-choline as donor. Regulates receptor-mediated signal transduction via mitogenic DAG and proapoptotic CER, as well as via SM, a structural component of membrane rafts that serve as platforms for signal transduction and protein sorting. Plays a role in secretory transport via regulation of DAG pool at the Golgi apparatus and its downstream effects on PRKD1.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
| ChEMBL ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BTD Probe Info |
![]() |
C50(0.72) | LDD2092 | [1] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [2] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0558 | 2-Cyano-N-phenylacetamide | MDA-MB-231 | C50(1.10) | LDD2152 | [1] |
| LDCM0499 | Nucleophilic fragment 12b | MDA-MB-231 | C50(0.72) | LDD2092 | [1] |
| LDCM0500 | Nucleophilic fragment 13a | MDA-MB-231 | C50(1.07) | LDD2093 | [1] |
| LDCM0501 | Nucleophilic fragment 13b | MDA-MB-231 | C50(0.86) | LDD2094 | [1] |
| LDCM0505 | Nucleophilic fragment 15b | MDA-MB-231 | C50(0.98) | LDD2098 | [1] |
| LDCM0506 | Nucleophilic fragment 16a | MDA-MB-231 | C50(1.10) | LDD2099 | [1] |
| LDCM0511 | Nucleophilic fragment 18b | MDA-MB-231 | C50(1.04) | LDD2104 | [1] |
| LDCM0514 | Nucleophilic fragment 20a | MDA-MB-231 | C50(0.94) | LDD2107 | [1] |
| LDCM0518 | Nucleophilic fragment 22a | MDA-MB-231 | C50(1.13) | LDD2111 | [1] |
| LDCM0526 | Nucleophilic fragment 26a | MDA-MB-231 | C50(1.78) | LDD2119 | [1] |
| LDCM0530 | Nucleophilic fragment 28a | MDA-MB-231 | C50(1.08) | LDD2123 | [1] |
| LDCM0534 | Nucleophilic fragment 30a | MDA-MB-231 | C50(1.18) | LDD2127 | [1] |
| LDCM0536 | Nucleophilic fragment 31 | MDA-MB-231 | C50(1.05) | LDD2129 | [1] |
| LDCM0542 | Nucleophilic fragment 37 | MDA-MB-231 | C50(0.60) | LDD2135 | [1] |
| LDCM0543 | Nucleophilic fragment 38 | MDA-MB-231 | C50(1.62) | LDD2136 | [1] |
| LDCM0544 | Nucleophilic fragment 39 | MDA-MB-231 | C50(1.18) | LDD2137 | [1] |
| LDCM0550 | Nucleophilic fragment 5a | MDA-MB-231 | C50(3.78) | LDD2144 | [1] |
| LDCM0559 | Nucleophilic fragment 9b | MDA-MB-231 | C50(2.00) | LDD2153 | [1] |
References


