Details of the Target
General Information of Target
| Target ID | LDTP08282 | |||||
|---|---|---|---|---|---|---|
| Target Name | Serine incorporator 5 (SERINC5) | |||||
| Gene Name | SERINC5 | |||||
| Gene ID | 256987 | |||||
| Synonyms |
C5orf12; Serine incorporator 5 |
|||||
| 3D Structure | ||||||
| Sequence |
MSAQCCAGQLACCCGSAGCSLCCDCCPRIRQSLSTRFMYALYFILVVVLCCIMMSTTVAH
KMKEHIPFFEDMCKGIKAGDTCEKLVGYSAVYRVCFGMACFFFIFCLLTLKINNSKSCRA HIHNGFWFFKLLLLGAMCSGAFFIPDQDTFLNAWRYVGAVGGFLFIGIQLLLLVEFAHKW NKNWTAGTASNKLWYASLALVTLIMYSIATGGLVLMAVFYTQKDSCMENKILLGVNGGLC LLISLVAISPWVQNRQPHSGLLQSGVISCYVTYLTFSALSSKPAEVVLDEHGKNVTICVP DFGQDLYRDENLVTILGTSLLIGCILYSCLTSTTRSSSDALQGRYAAPELEIARCCFCFS PGGEDTEEQQPGKEGPRVIYDEKKGTVYIYSYFHFVFFLASLYVMMTVTNWFNHVRSAFH LLP |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
TDE1 family
|
|||||
| Subcellular location |
Cytoplasm, perinuclear region; Cell membrane
|
|||||
| Function |
Restriction factor required to restrict infectivity of lentiviruses, such as HIV-1: acts by inhibiting an early step of viral infection. Impairs the penetration of the viral particle into the cytoplasm. Enhances the incorporation of serine into phosphatidylserine and sphingolipids. May play a role in providing serine molecules for the formation of myelin glycosphingolipids in oligodendrocytes.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IA-alkyne Probe Info |
 |
0.54 | LDD2183 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0625 | F8 | Ramos | C82(1.49) | LDD2187 | [1] |
| LDCM0572 | Fragment10 | Ramos | C82(3.86) | LDD2189 | [1] |
| LDCM0573 | Fragment11 | Ramos | C82(1.48); 1.07 | LDD2190 | [1] |
| LDCM0580 | Fragment21 | Ramos | 0.71 | LDD2195 | [1] |
| LDCM0578 | Fragment27 | Ramos | 0.71 | LDD2197 | [1] |
| LDCM0586 | Fragment28 | Ramos | 1.55 | LDD2198 | [1] |
| LDCM0588 | Fragment30 | Ramos | C82(2.23); 0.37 | LDD2199 | [1] |
| LDCM0468 | Fragment33 | Ramos | 0.78 | LDD2202 | [1] |
| LDCM0566 | Fragment4 | Ramos | C82(2.19) | LDD2184 | [1] |
| LDCM0614 | Fragment56 | Ramos | C82(4.25) | LDD2205 | [1] |
| LDCM0569 | Fragment7 | Ramos | C82(1.15); 1.35 | LDD2186 | [1] |
| LDCM0023 | KB03 | Ramos | 0.54 | LDD2183 | [1] |