Details of the Target
General Information of Target
| Target ID | LDTP08221 | |||||
|---|---|---|---|---|---|---|
| Target Name | E3 ubiquitin-protein ligase MARCHF3 (MARCHF3) | |||||
| Gene Name | MARCHF3 | |||||
| Gene ID | 115123 | |||||
| Synonyms |
MARCH3; RNF173; E3 ubiquitin-protein ligase MARCHF3; EC 2.3.2.27; Membrane-associated RING finger protein 3; Membrane-associated RING-CH protein III; MARCH-III; RING finger protein 173; RING-type E3 ubiquitin transferase MARCHF3
|
|||||
| 3D Structure | ||||||
| Sequence |
MTTSRCSHLPEVLPDCTSSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLA
TQSPFNDRPMCRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRF AVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRL EAVGLIALTVALFTIYLFWTLVSFRYHCRLYNEWRRTNQRVILLIPKSVNVPSNQPSLLG LHSVKRNSKETVV |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Subcellular location |
Cytoplasmic vesicle membrane
|
|||||
| Function |
E3 ubiquitin-protein ligase which may be involved in endosomal trafficking. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C16(1.29); C6(1.29) | LDD0078 | [1] | |
Competitor(s) Related to This Target

