Details of the Target
General Information of Target
| Target ID | LDTP08167 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein S100-A7A (S100A7A) | |||||
| Gene Name | S100A7A | |||||
| Gene ID | 338324 | |||||
| Synonyms |
S100A15; S100A7L1; Protein S100-A7A; S100 calcium-binding protein A15; S100 calcium-binding protein A7-like 1; S100 calcium-binding protein A7A |
|||||
| 3D Structure | ||||||
| Sequence |
MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFE
KKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
S-100 family
|
|||||
| Subcellular location |
Cytoplasm
|
|||||
| Function | May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C47(2.75); C96(3.28) | LDD2268 | [1] | |
Competitor(s) Related to This Target

