Details of the Target
General Information of Target
| Target ID | LDTP08161 | |||||
|---|---|---|---|---|---|---|
| Target Name | RNA-binding Raly-like protein (RALYL) | |||||
| Gene Name | RALYL | |||||
| Gene ID | 138046 | |||||
| Synonyms |
HNRPCL3; RNA-binding Raly-like protein; hRALYL; Heterogeneous nuclear ribonucleoprotein C-like 3; hnRNP core protein C-like 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFV
QYMSERHARAAVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLS VGGYVFDYDYYRDDFYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSR STASGSTGSKLKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKAEAEAQKKQLEESLV LIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
RRM HNRPC family, RALY subfamily
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
BTD Probe Info |
![]() |
C51(1.65) | LDD1699 | [1] | |
|
DBIA Probe Info |
![]() |
C64(2.75) | LDD3323 | [2] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [3] | |
|
WYneN Probe Info |
![]() |
N.A. | LDD0021 | [4] | |
|
IPM Probe Info |
![]() |
N.A. | LDD0147 | [5] | |
|
TFBX Probe Info |
![]() |
N.A. | LDD0148 | [5] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0217 | [6] | |
|
Cinnamaldehyde Probe Info |
![]() |
N.A. | LDD0220 | [6] | |
|
Crotonaldehyde Probe Info |
![]() |
C51(0.00); H54(0.00) | LDD0219 | [6] | |
|
Methacrolein Probe Info |
![]() |
N.A. | LDD0218 | [6] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0108 | Chloroacetamide | HeLa | C51(0.00); H54(0.00) | LDD0222 | [6] |
| LDCM0107 | IAA | HeLa | C51(0.00); H54(0.00) | LDD0221 | [6] |
| LDCM0022 | KB02 | A-375 | C64(1.82) | LDD2255 | [2] |
| LDCM0023 | KB03 | A-375 | C64(2.36) | LDD2672 | [2] |
| LDCM0024 | KB05 | SKMEL24 | C64(2.75) | LDD3323 | [2] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0223 | [6] |
| LDCM0523 | Nucleophilic fragment 24b | MDA-MB-231 | C51(0.18) | LDD2116 | [1] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A) | CAMK Ser/Thr protein kinase family | Q9UQM7 | |||
| Apoptosis-enhancing nuclease (AEN) | . | Q8WTP8 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| THAP domain-containing protein 1 (THAP1) | THAP1 family | Q9NVV9 | |||
Other
References










