Details of the Target

General Information of Target

Target ID LDTP08160
Target Name Transmembrane protein 179B (TMEM179B)
Gene Name TMEM179B
Gene ID 374395
Synonyms
Transmembrane protein 179B
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MALSWLQRVELALFAAAFLCGAVAAAAMTRTQGSFSGRCPLYGVATLNGSSLALSRPSAP
SLCYFVAGASGLLALYCLLLLLFWIYSSCIEDSHRGAIGLRIALAISAIAVFLVLVSACI
LRFGTRSLCNSIISLNTTISCSEAQKIPWTPPGTALQFYSNLHNAETSSWVNLVLWCVVL
VLQVVQWKSEATPYRPLERGDPEWSSETDALVGSRLSHS
Target Bioclass
Transporter and channel
Family
TMEM179 family
Subcellular location
Membrane
Uniprot ID
Q7Z7N9
Ensemble ID
ENST00000333449.9
HGNC ID
HGNC:33744

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
AOyne
 Probe Info  		9.30  LDD0443  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Lysozyme g-like protein 1 (LYG1) Glycosyl hydrolase 23 family Q8N1E2
Polypeptide N-acetylgalactosaminyltransferase 15 (GALNT15) Glycosyltransferase 2 family Q8N3T1
E3 ubiquitin-protein ligase MARCHF2 (MARCHF2) . Q9P0N8
Transmembrane ascorbate-dependent reductase CYB561 (CYB561) . P49447
Transporter and channel
Click To Hide/Show 17 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Bcl-2-like protein 2 (BCL2L2) Bcl-2 family Q92843
H(+)/Cl(-) exchange transporter 7 (CLCN7) Chloride channel (TC 2.A.49) family P51798
Claudin-1 (CLDN1) Claudin family O95832
Derlin-3 (DERL3) Derlin family Q96Q80
Excitatory amino acid transporter 3 (SLC1A1) Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family P43005
Gastrokine-1 (GKN1) Gastrokine family Q9NS71
Integral membrane protein 2A (ITM2A) ITM2 family O43736
Transmembrane 4 L6 family member 19 (TM4SF19) L6 tetraspanin family Q96DZ7
Molybdate-anion transporter (MFSD5) Major facilitator superfamily Q6N075
Major facilitator superfamily domain-containing protein 6 (MFSD6) MFSD6 family Q6ZSS7
Cardiac phospholamban (PLN) Phospholamban family P26678
Solute carrier family 52, riboflavin transporter, member 1 (SLC52A1) Riboflavin transporter family Q9NWF4
Transmembrane protein 14A (TMEM14A) TMEM14 family Q9Y6G1
Transmembrane protein 242 (TMEM242) TMEM242 family Q9NWH2
Transmembrane protein 47 (TMEM47) TMEM47 family Q9BQJ4
Adiponectin (ADIPOQ) . Q15848
Phospholipid transfer protein C2CD2L (C2CD2L) . O14523
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
G-protein coupled receptor 151 (GPR151) G-protein coupled receptor 1 family Q8TDV0
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Butyrophilin subfamily 2 member A2 (BTN2A2) BTN/MOG family Q8WVV5
Cytokine and receptor
Click To Hide/Show 3 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
C-C motif chemokine 3-like 1 (CCL3L1; CCL3L3) Intercrine beta (chemokine CC) family P16619
C-C motif chemokine 4 (CCL4) Intercrine beta (chemokine CC) family P13236
C-C motif chemokine 4-like (CCL4L1; CCL4L2) Intercrine beta (chemokine CC) family Q8NHW4
Other
Click To Hide/Show 18 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Apolipoprotein L2 (APOL2) Apolipoprotein L family Q9BQE5
Claudin-6 (CLDN6) Claudin family P56747
Cortexin-3 (CTXN3) Cortexin family Q4LDR2
Endoplasmic reticulum-Golgi intermediate compartment protein 3 (ERGIC3) ERGIC family Q9Y282
Protein FAM163A (FAM163A) FAM163 family Q96GL9
Glycoprotein hormone beta-5 (GPHB5) Glycoprotein hormones subunit beta family Q86YW7
Guanylin (GUCA2A) Guanylin family Q02747
Keratin-associated protein 12-2 (KRTAP12-2) KRTAP type 12 family P59991
Macrosialin (CD68) LAMP family P34810
Low-density lipoprotein receptor-related protein 10 (LRP10) LDLR family Q7Z4F1
Stress-associated endoplasmic reticulum protein 2 (SERP2) RAMP4 family Q8N6R1
Syntaxin-8 (STX8) Syntaxin family Q9UNK0
Transmembrane protein 236 (TMEM236) TMEM236 family Q5W0B7
Coiled-coil domain-containing protein 167 (CCDC167) . Q9P0B6
Complement C1q-like protein 4 (C1QL4) . Q86Z23
Fetal and adult testis-expressed transcript protein (FATE1) . Q969F0
Insulin-like growth factor-binding protein 5 (IGFBP5) . P24593
TPA-induced transmembrane protein (TTMP) . Q5BVD1

References

1 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.