Details of the Target
General Information of Target
Target ID | LDTP08127 | |||||
---|---|---|---|---|---|---|
Target Name | Arpin (ARPIN) | |||||
Gene Name | ARPIN | |||||
Gene ID | 348110 | |||||
Synonyms |
C15orf38; Arpin; Arp2/3 inhibition protein |
|||||
3D Structure | ||||||
Sequence |
MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYY
VLYIRPSHIHRRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLV NKPELLALTESLTPDHTVAFWMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTV TKCNFTGDGKTGASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWDD |
|||||
Target Bioclass |
Other
|
|||||
Family |
Arpin family
|
|||||
Subcellular location |
Cell projection, lamellipodium
|
|||||
Function |
Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competitive with nucleation promoting factors. Participates in an incoherent feedforward loop at the lamellipodium tip where it inhibits the ARP2/2 complex in response to Rac signaling and where Rac also stimulates actin polymerization through the WAVE complex. Involved in steering cell migration by controlling its directional persistence.
|
|||||
Uniprot ID | ||||||
Ensemble ID | ||||||
HGNC ID |
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C183(2.94) | LDD3493 | [1] | |
HHS-475 Probe Info |
![]() |
Y5(1.13) | LDD0264 | [2] | |
HHS-465 Probe Info |
![]() |
Y5(10.00) | LDD2237 | [3] | |
m-APA Probe Info |
![]() |
N.A. | LDD2231 | [4] | |
IA-alkyne Probe Info |
![]() |
N.A. | LDD0162 | [5] | |
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [6] | |
TFBX Probe Info |
![]() |
N.A. | LDD0027 | [7] | |
WYneN Probe Info |
![]() |
N.A. | LDD0021 | [8] | |
IPM Probe Info |
![]() |
N.A. | LDD0005 | [8] | |
Phosphinate-6 Probe Info |
![]() |
N.A. | LDD0018 | [9] |
Competitor(s) Related to This Target
Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
---|---|---|---|---|---|
LDCM0213 | Electrophilic fragment 2 | MDA-MB-231 | C183(1.13) | LDD1702 | [10] |
LDCM0116 | HHS-0101 | DM93 | Y5(1.13) | LDD0264 | [2] |
LDCM0117 | HHS-0201 | DM93 | Y5(0.63) | LDD0265 | [2] |
LDCM0118 | HHS-0301 | DM93 | Y5(0.37) | LDD0266 | [2] |
LDCM0120 | HHS-0701 | DM93 | Y5(0.17) | LDD0268 | [2] |
LDCM0022 | KB02 | AU565 | C183(4.43) | LDD2265 | [1] |
LDCM0023 | KB03 | MDA-MB-231 | C183(2.34) | LDD1701 | [10] |
LDCM0024 | KB05 | ZR-75-1 | C183(2.94) | LDD3493 | [1] |
LDCM0627 | NUDT7-COV-1 | HEK-293T | C183(0.66) | LDD2206 | [11] |
LDCM0628 | OTUB2-COV-1 | HEK-293T | C183(0.63); C183(0.18) | LDD2207 | [11] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Other
Protein name | Family | Uniprot ID | |||
---|---|---|---|---|---|
Actin-related protein 2/3 complex subunit 2 (ARPC2) | ARPC2 family | O15144 | |||
DNA damage-inducible transcript 4-like protein (DDIT4L) | DDIT4 family | Q96D03 |
References