Details of the Target

General Information of Target

Target ID LDTP08080
Target Name Zinc finger protein 438 (ZNF438)
Gene Name ZNF438
Gene ID 220929
Synonyms
Zinc finger protein 438
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MQNSVSVPPKDEGESNIPSGTIQSRKGLQNKSQFRTIAPKIVPKVLTSRMLPCHSPSRSD
QVNLGPSINSKLLGMSTQNYALMQVAGQEGTFSLVALPHVASAQPIQKPRMSLPENLKLP
IPRYQPPRNSKASRKKPILIFPKSGCSKAPAQTQMCPQMSPSPPHHPELLYKPSPFEEVP
SLEQAPASISTAALTNGSDHGDLRPPVTNTHGSLNPPATPASSTPEEPAKQDLTALSGKA
HFVSKITSSKPSAVASEKFKEQVDLAKTMTNLSPTILGNAVQLISSVPKGKLPIPPYSRM
KTMEVYKIKSDANIAGFSLPGPKADCDKIPSTTEGFNAATKVASRLPVPQVSQQSACESA
FCPPTKLDLNHKTKLNSGAAKRKGRKRKVPDEILAFQGKRRKYIINKCRDGKERVKNDPQ
EFRDQKLGTLKKYRSIMPKPIMVIPTLASLASPTTLQSQMLGGLGQDVLLNNSLTPKYLG
CKQDNSSSPKPSSVFRNGFSGIKKPWHRCHVCNHHFQFKQHLRDHMNTHTNRRPYSCRIC
RKSYVRPGSLSTHMKLHHGENRLKKLMCCEFCAKVFGHIRVYFGHLKEVHRVVISTEPAP
SELQPGDIPKNRDMSVRGMEGSLERENKSNLEEDFLLNQADEVKLQIKCGRCQITAQSFA
EIKFHLLDVHGEEIEGRLQEGTFPGSKGTQEELVQHASPDWKRHPERGKPEKVHSSSEES
HACPRLKRQLHLHQNGVEMLMENEGPQSGTNKPRETCQGPECPGLHTFLLWSHSGFNCLL
CAEMLGRKEDLLHHWKHQHNCEDPSKLWAILNTVSNQGVIELSSEAEK
Target Bioclass
Transcription factor
Family
Krueppel C2H2-type zinc-finger protein family
Subcellular location
Nucleus
Function Isoform 1 acts as a transcriptional repressor.
Uniprot ID
Q7Z4V0
Ensemble ID
ENST00000331737.10
HGNC ID
HGNC:21029

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
CAL33 SNV: p.M300K .
HCC1143 SNV: p.K381N .
KMRC20 SNV: p.T91I .
MDAMB231 SNV: p.E226Q .
MEC1 Deletion: p.R35_T36del .
NCIH196 SNV: p.P228L .
NCIH3122 SNV: p.A218S .
SW756 SNV: p.S310L .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Lodoacetamide azide
 Probe Info  		N.A.  LDD0037  [1]
TER-AC
 Probe Info  		N.A.  LDD0426  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 12 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Protein arginine N-methyltransferase 7 (PRMT7) Protein arginine N-methyltransferase family Q9NVM4
Histone-lysine N-methyltransferase SUV39H1 (SUV39H1) Histone-lysine methyltransferase family O43463
Phenylalanine--tRNA ligase, mitochondrial (FARS2) Class-II aminoacyl-tRNA synthetase family O95363
Ribonuclease P protein subunit p25 (RPP25) Histone-like Alba family Q9BUL9
Ubiquitin thioesterase ZRANB1 (ZRANB1) Peptidase C64 family Q9UGI0
Proteasome subunit beta type-1 (PSMB1) Peptidase T1B family P20618
Cyclin-dependent kinase 18 (CDK18) CMGC Ser/Thr protein kinase family Q07002
Tyrosine-protein kinase Yes (YES1) Tyr protein kinase family P07947
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
E3 ubiquitin-protein ligase TRIM50 (TRIM50) TRIM/RBCC family Q86XT4
E3 ubiquitin-protein ligase MYLIP (MYLIP) . Q8WY64
Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 2 (TSTD2) . Q5T7W7
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
MyoD family inhibitor (MDFI) MDFI family Q99750
Nuclear RNA export factor 1 (NXF1) NXF family Q9UBU9
Sperm protein associated with the nucleus on the X chromosome N2 (SPANXN2) SPAN-X family Q5MJ10
Sodium channel modifier 1 (SCNM1) . Q9BWG6
Transcription factor
Click To Hide/Show 9 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transcription regulator protein BACH2 (BACH2) BZIP family Q9BYV9
Doublesex- and mab-3-related transcription factor 3 (DMRT3) DMRT family Q9NQL9
Zinc finger protein 143 (ZNF143) GLI C2H2-type zinc-finger protein family P52747
Zinc finger protein 17 (ZNF17) Krueppel C2H2-type zinc-finger protein family P17021
Zinc finger protein 526 (ZNF526) Krueppel C2H2-type zinc-finger protein family Q8TF50
Zinc finger protein 629 (ZNF629) Krueppel C2H2-type zinc-finger protein family Q9UEG4
Zinc finger protein 648 (ZNF648) Krueppel C2H2-type zinc-finger protein family Q5T619
Zinc finger and BTB domain-containing protein 8A (ZBTB8A) . Q96BR9
Zinc finger protein 202 (ZNF202) . O95125
Immunoglobulin
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Hyaluronan and proteoglycan link protein 2 (HAPLN2) HAPLN family Q9GZV7
Other
Click To Hide/Show 24 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Afadin- and alpha-actinin-binding protein (SSX2IP) ADIP family Q9Y2D8
Bystin (BYSL) Bystin family Q13895
Testis-specific gene 10 protein (TSGA10) CEP135/TSGA10 family Q9BZW7
Centrosomal protein of 19 kDa (CEP19) CEP19 family Q96LK0
Cysteine-rich tail protein 1 (CYSRT1) CYSRT1 family A8MQ03
Diphthamide biosynthesis protein 3 (DPH3) DPH3 family Q96FX2
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Golgin subfamily A member 6-like protein 9 (GOLGA6L9) GOLGA6 family A6NEM1
Keratin, type I cytoskeletal 40 (KRT40) Intermediate filament family Q6A162
Protein mago nashi homolog 2 (MAGOHB) Mago nashi family Q96A72
Colorectal mutant cancer protein (MCC) MCC family P23508
PIH1 domain-containing protein 2 (PIH1D2) PIH1 family Q8WWB5
Paraneoplastic antigen Ma1 (PNMA1) PNMA family Q8ND90
Rab GTPase-binding effector protein 1 (RABEP1) Rabaptin family Q15276
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 (SMARCD1) SMARCD family Q96GM5
Synaptotagmin-17 (SYT17) Synaptotagmin family Q9BSW7
Large ribosomal subunit protein uL11m (MRPL11) Universal ribosomal protein uL11 family Q9Y3B7
Bcl-2-binding component 3, isoforms 3/4 (BBC3) . Q96PG8
Cell division cycle-associated 7-like protein (CDCA7L) . Q96GN5
Fibroblast growth factor receptor substrate 3 (FRS3) . O43559
MORN repeat-containing protein 3 (MORN3) . Q6PF18
Placental protein 13-like (LGALS14) . Q8TCE9
PRKCA-binding protein (PICK1) . Q9NRD5
TBC1 domain family member 22B (TBC1D22B) . Q9NU19

References

1 Enhancing Cysteine Chemoproteomic Coverage through Systematic Assessment of Click Chemistry Product Fragmentation. Anal Chem. 2022 Mar 8;94(9):3800-3810. doi: 10.1021/acs.analchem.1c04402. Epub 2022 Feb 23.
Mass spectrometry data entry: PXD028853
2 Differently Tagged Probes for Protein Profiling of Mitochondria. Chembiochem. 2019 May 2;20(9):1155-1160. doi: 10.1002/cbic.201800735. Epub 2019 Mar 26.