Details of the Target
General Information of Target
| Target ID | LDTP08056 | |||||
|---|---|---|---|---|---|---|
| Target Name | E3 ubiquitin-protein ligase RNF144B (RNF144B) | |||||
| Gene Name | RNF144B | |||||
| Gene ID | 255488 | |||||
| Synonyms |
IBRDC2; P53RFP; E3 ubiquitin-protein ligase RNF144B; EC 2.3.2.31; IBR domain-containing protein 2; RING finger protein 144B; p53-inducible RING finger protein |
|||||
| 3D Structure | ||||||
| Sequence |
MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQY
MQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPYRTW CPVADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRA LFGTDAEAPIKQCPVCRVYIERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDKGPC RNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLLASPCIICCVCKSCRGKKKKHDP STT |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
RBR family, RNF144 subfamily
|
|||||
| Subcellular location |
Mitochondrion membrane
|
|||||
| Function |
E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2, thereby promoting their degradation. Induces apoptosis via a p53/TP53-dependent but caspase-independent mechanism. However, its overexpression also produces a decrease of the ubiquitin-dependent stability of BAX, a pro-apoptotic protein, ultimately leading to protection of cell death; But, it is not an anti-apoptotic protein per se.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C77(2.25) | LDD3379 | [1] | |
Competitor(s) Related to This Target

