Details of the Target

General Information of Target

Target ID LDTP08053
Target Name Peroxisome assembly protein 26 (PEX26)
Gene Name PEX26
Gene ID 55670
Synonyms
Peroxisome assembly protein 26; Peroxin-26
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MKSDSSTSAAPLRGLGGPLRSSEPVRAVPARAPAVDLLEEAADLLVVHLDFRAALETCER
AWQSLANHAVAEEPAGTSLEVKCSLCVVGIQALAEMDRWQEVLSWVLQYYQVPEKLPPKV
LELCILLYSKMQEPGAVLDVVGAWLQDPANQNLPEYGALAEFHVQRVLLPLGCLSEAEEL
VVGSAAFGEERRLDVLQAIHTARQQQKQEHSGSEEAQKPNLEGSVSHKFLSLPMLVRQLW
DSAVSHFFSLPFKKSLLAALILCLLVVRFDPASPSSLHFLYKLAQLFRWIRKAAFSRLYQ
LRIRD
Target Bioclass
Transporter and channel
Family
Peroxin-26 family
Subcellular location
Peroxisome membrane
Function
Peroxisomal docking factor that anchors PEX1 and PEX6 to peroxisome membranes . PEX26 is therefore required for the formation of the PEX1-PEX6 AAA ATPase complex, a complex that mediates the extraction of the PEX5 receptor from peroxisomal membrane .
Uniprot ID
Q7Z412
Ensemble ID
ENST00000329627.11
HGNC ID
HGNC:22965

Target Site Mutations in Different Cell Lines

Cell line Mutation details Probe for labeling this protein in this cell
LNCaP clone FGC SNV: p.E178G .
PATU8988T SNV: p.V225I .

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 2 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
DBIA
 Probe Info  		C58(3.46)  LDD3314  [1]
TFBX
 Probe Info  		N.A.  LDD0027  [2]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0022  KB02 22RV1 C58(2.07)  LDD2243  [1]
 LDCM0023  KB03 22RV1 C58(4.24)  LDD2660  [1]
 LDCM0024  KB05 IGR37 C58(3.46)  LDD3314  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 8 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Alpha/beta hydrolase domain-containing protein 17C (ABHD17C) ABHD17 family Q6PCB6
COP9 signalosome complex subunit 3 (COPS3) CSN3 family Q9UNS2
Polyamine deacetylase HDAC10 (HDAC10) Histone deacetylase family Q969S8
Methionine-R-sulfoxide reductase B2, mitochondrial (MSRB2) MsrB Met sulfoxide reductase family Q9Y3D2
Zinc-regulated GTPase metalloprotein activator 1C (ZNG1C) SIMIBI class G3E GTPase family Q5JTY5
ADP-ribosylation factor-like protein 16 (ARL16) Arf family Q0P5N6
RING finger protein 112 (RNF112) GB1/RHD3 GTPase family Q9ULX5
Probable E3 ubiquitin-protein ligase makorin-3 (MKRN3) . Q13064
Transporter and channel
Click To Hide/Show 2 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Cellular tumor antigen p53 (TP53) P53 family P04637
Peroxisomal biogenesis factor 19 (PEX19) Peroxin-19 family P40855
Transcription factor
Click To Hide/Show 5 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Transcription factor E2F8 (E2F8) E2F/DP family A0AVK6
Achaete-scute homolog 4 (ASCL4) . Q6XD76
Forkhead box protein R1 (FOXR1) . Q6PIV2
Homeobox protein MOX-1 (MEOX1) . P50221
LIM/homeobox protein Lhx5 (LHX5) . Q9H2C1
Other
Click To Hide/Show 14 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Bcl-2-modifying factor (BMF) Bcl-2 family Q96LC9
Death domain-associated protein 6 (DAXX) DAXX family Q9UER7
Protein FAM78A (FAM78A) FAM78 family Q5JUQ0
Baculoviral IAP repeat-containing protein 5 (BIRC5) IAP family O15392
Kinesin light chain 3 (KLC3) Kinesin light chain family Q6P597
Keratin-associated protein 19-1 (KRTAP19-1) KRTAP type 19 family Q8IUB9
Keratin-associated protein 8-1 (KRTAP8-1) KRTAP type 8 family Q8IUC2
Prefoldin subunit 5 (PFDN5) Prefoldin subunit alpha family Q99471
Suppressor of fused homolog (SUFU) SUFU family Q9UMX1
Bublin coiled-coil protein (BBLN) UPF0184 (EST00098) family Q9BUW7
Nebulette (NEBL) . O76041
Spindle assembly abnormal protein 6 homolog (SASS6) . Q6UVJ0
Superkiller complex protein 8 (SKIC8) . Q9GZS3
Zinc finger matrin-type protein 2 (ZMAT2) . Q96NC0

References

1 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
2 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255