Details of the Target
General Information of Target
| Target ID | LDTP08039 | |||||
|---|---|---|---|---|---|---|
| Target Name | Notch homolog 2 N-terminal-like protein A (NOTCH2NLA) | |||||
| Gene Name | NOTCH2NLA | |||||
| Gene ID | 388677 | |||||
| Synonyms |
N2N; NOTCH2NL; Notch homolog 2 N-terminal-like protein A; Notch homolog 2 N-terminal-like protein |
|||||
| 3D Structure | ||||||
| Sequence |
MCVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGE
DCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTC TTVANQFSCKCLTGFTGQKCETDVNECDIPGHCQHGGTCLNLPGSYQCQCLQGFTGQYCD SLYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGKEHDEN |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
NOTCH family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Human-specific protein that promotes neural progenitor proliferation and evolutionary expansion of the brain neocortex by regulating the Notch signaling pathway. Able to promote neural progenitor self-renewal, possibly by down-regulating neuronal differentiation genes, thereby delaying the differentiation of neuronal progenitors and leading to an overall final increase in neuronal production. Acts by enhancing the Notch signaling pathway via two different mechanisms that probably work in parallel to reach the same effect. Enhances Notch signaling pathway in a non-cell-autonomous manner via direct interaction with NOTCH2. Also promotes Notch signaling pathway in a cell-autonomous manner through inhibition of cis DLL1-NOTCH2 interactions, which promotes neuronal differentiation.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C170(2.26) | LDD3369 | [1] | |
Competitor(s) Related to This Target

