Details of the Target

General Information of Target

Target ID LDTP08034
Target Name Zinc finger protein 572 (ZNF572)
Gene Name ZNF572
Gene ID 137209
Synonyms
Zinc finger protein 572
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MEQEKKLLVSDSNSFMERESLKSPFTGDTSMNNLETVHHNNSKADKLKEKPSEWSKRHRP
QHYKHEDAKEMPLTWVQDEIWCHDSYESDGKSENWGNFIAKEEEKPNHQEWDSGEHTNAC
VQQNSSFVDRPYKCSECWKSFSNSSHLRTHQRTHSGEKPYKCSECAKCFCNSSHLIQHLR
MHTGEKPYQCGECGKSFSNTSHLIIHERTHTGEKPYKCPECGKRFSSSSHLIQHHRSHTG
EKPYECSVCGKGFSHSYVLIEHQRTHTGEKPYKCPDCGKSFSQSSSLIRHQRTHTGEKPY
KCLECEKSFGCNSTLIKHQRIHTGEKPYQCPECGKNFSRSSNLITHQKMHTGEKSYESSE
YEESLGQNCNVIEECRIQLGEKPYRCCECGKSFGLSSHLIRHQRTHTGEKPYRCSECWKT
FSQSSTLVIHQRTHTGEKPYKCPDCGESFSQSFNLIRHRRTHIGEKPYKCTSCEKCFSRS
AYLSQHRKIHVEKPFESPDVGDFPHEWTWKNCSGEMPFISSFSVSNSSS
Target Bioclass
Transcription factor
Family
Krueppel C2H2-type zinc-finger protein family
Subcellular location
Nucleus
Function May be involved in transcriptional regulation.
Uniprot ID
Q7Z3I7
Ensemble ID
ENST00000319286.6
HGNC ID
HGNC:26758

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 1 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
HHS-465
 Probe Info  		K214(0.00); K217(0.00); Y216(0.00)  LDD2240  [1]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 6 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
TNF receptor-associated factor 2 (TRAF2) TNF receptor-associated factor family Q12933
Kinesin-like protein KIF9 (KIF9) Kinesin family Q9HAQ2
Kinesin-like protein KIFC3 (KIFC3) Kinesin family Q9BVG8
Zinc finger protein RFP (TRIM27) TRIM/RBCC family P14373
Fibronectin type III and SPRY domain-containing protein 2 (FSD2) . A1L4K1
Tripartite motif-containing protein 54 (TRIM54) . Q9BYV2
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Huntingtin (HTT) Huntingtin family P42858
Leucine zipper putative tumor suppressor 1 (LZTS1) LZTS family Q9Y250
MyoD family inhibitor (MDFI) MDFI family Q99750
Wolframin (WFS1) . O76024
Transcription factor
Click To Hide/Show 11 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 165 (ZNF165) Krueppel C2H2-type zinc-finger protein family P49910
Zinc finger protein 383 (ZNF383) Krueppel C2H2-type zinc-finger protein family Q8NA42
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 57 (ZNF57) Krueppel C2H2-type zinc-finger protein family Q68EA5
Zinc finger protein 572 (ZNF572) Krueppel C2H2-type zinc-finger protein family Q7Z3I7
Zinc finger protein 774 (ZNF774) Krueppel C2H2-type zinc-finger protein family Q6NX45
Zinc finger protein 835 (ZNF835) Krueppel C2H2-type zinc-finger protein family Q9Y2P0
Homeobox protein MOX-2 (MEOX2) . P50222
Proto-oncogene c-Rel (REL) . Q04864
Zinc finger and BTB domain-containing protein 1 (ZBTB1) . Q9Y2K1
Zinc finger and BTB domain-containing protein 8A (ZBTB8A) . Q96BR9
GPCR
Click To Hide/Show 1 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Melatonin-related receptor (GPR50) G-protein coupled receptor 1 family Q13585
Other
Click To Hide/Show 37 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Atos homolog protein B (ATOSB) ATOS family Q7L5A3
BolA-like protein 1 (BOLA1) BolA/IbaG family Q9Y3E2
Cerebellar degeneration-related protein 2-like (CDR2L) CDR2 family Q86X02
Deuterosome assembly protein 1 (DEUP1) CEP63 family Q05D60
Probable splicing factor YJU2B (YJU2B) CWC16 family P13994
Dynein regulatory complex subunit 4 (GAS8) DRC4 family O95995
Pre-mRNA-splicing regulator WTAP (WTAP) Fl(2)d family Q15007
Golgin subfamily A member 2 (GOLGA2) GOLGA2 family Q08379
Progranulin (GRN) Granulin family P28799
Protein Hook homolog 1 (HOOK1) Hook family Q9UJC3
Glial fibrillary acidic protein (GFAP) Intermediate filament family P14136
Keratin, type I cuticular Ha1 (KRT31) Intermediate filament family Q15323
Neurofilament light polypeptide (NEFL) Intermediate filament family P07196
Peripherin (PRPH) Intermediate filament family P41219
Prelamin-A/C (LMNA) Intermediate filament family P02545
Vimentin (VIM) Intermediate filament family P08670
Kinesin light chain 3 (KLC3) Kinesin light chain family Q6P597
Keratin-associated protein 10-5 (KRTAP10-5) KRTAP type 10 family P60370
Keratin-associated protein 10-7 (KRTAP10-7) KRTAP type 10 family P60409
Keratin-associated protein 10-8 (KRTAP10-8) KRTAP type 10 family P60410
Keratin-associated protein 10-9 (KRTAP10-9) KRTAP type 10 family P60411
Leucine zipper putative tumor suppressor 2 (LZTS2) LZTS2 family Q9BRK4
Microtubule-associated tumor suppressor candidate 2 (MTUS2) MTUS1 family Q5JR59
Nuclear distribution protein nudE-like 1 (NDEL1) NudE family Q9GZM8
Tuftelin-interacting protein 11 (TFIP11) TFP11/STIP family Q9UBB9
Centrosomal protein CEP57L1 (CEP57L1) Translokin family Q8IYX8
Brain-enriched guanylate kinase-associated protein (BEGAIN) . Q9BUH8
Caspase recruitment domain-containing protein 9 (CARD9) . Q9H257
Centrosomal protein of 70 kDa (CEP70) . Q8NHQ1
Coiled-coil domain-containing protein 102B (CCDC102B) . Q68D86
Huntingtin-associated protein 1 (HAP1) . P54257
KATNB1-like protein 1 (KATNBL1) . Q9H079
Merlin (NF2) . P35240
Protein AF-9 (MLLT3) . P42568
Sperm-associated antigen 5 (SPAG5) . Q96R06
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) . Q7Z699
TNF receptor-associated factor 1 (TRAF1) . Q13077

References

1 Global profiling identifies a stress-responsive tyrosine site on EDC3 regulating biomolecular condensate formation. Cell Chem Biol. 2022 Dec 15;29(12):1709-1720.e7. doi: 10.1016/j.chembiol.2022.11.008. Epub 2022 Dec 6.
Mass spectrometry data entry: PXD038010