Details of the Target
General Information of Target
Target ID | LDTP07987 | |||||
---|---|---|---|---|---|---|
Target Name | CXXC-type zinc finger protein 5 (CXXC5) | |||||
Gene Name | CXXC5 | |||||
Gene ID | 51523 | |||||
Synonyms |
CXXC-type zinc finger protein 5; CF5; Putative MAPK-activating protein PM08; Putative NF-kappa-B-activating protein 102; Retinoid-inducible nuclear factor; RINF |
|||||
3D Structure | ||||||
Sequence |
MSSLGGGSQDAGGSSSSSTNGSGGSGSSGPKAGAADKSAVVAAAAPASVADDTPPPERRN
KSGIISEPLNKSLRRSRPLSHYSSFGSSGGSGGGSMMGGESADKATAAAAAASLLANGHD LAAAMAVDKSNPTSKHKSGAVASLLSKAERATELAAEGQLTLQQFAQSTEMLKRVVQEHL PLMSEAGAGLPDMEAVAGAEALNGQSDFPYLGAFPINPGLFIMTPAGVFLAESALHMAGL AEYPMQGELASAISSGKKKRKRCGMCAPCRRRINCEQCSSCRNRKTGHQICKFRKCEELK KKPSAALEKVMLPTGAAFRWFQ |
|||||
Target Type |
Literature-reported
|
|||||
Target Bioclass |
Other
|
|||||
Subcellular location |
Nucleus
|
|||||
Function |
May indirectly participate in activation of the NF-kappa-B and MAPK pathways. Acts as a mediator of BMP4-mediated modulation of canonical Wnt signaling activity in neural stem cells. Required for DNA damage-induced ATM phosphorylation, p53 activation and cell cycle arrest. Involved in myelopoiesis. Transcription factor. Binds to the oxygen responsive element of COX4I2 and represses its transcription under hypoxia conditions (4% oxygen), as well as normoxia conditions (20% oxygen). May repress COX4I2 transactivation induced by CHCHD2 and RBPJ. Binds preferentially to DNA containing cytidine-phosphate-guanosine (CpG) dinucleotides over CpH (H=A, T, and C), hemimethylated-CpG and hemimethylated-hydroxymethyl-CpG.
|
|||||
TTD ID | ||||||
Uniprot ID | ||||||
DrugMap ID | ||||||
Ensemble ID | ||||||
HGNC ID | ||||||
ChEMBL ID |
Target Site Mutations in Different Cell Lines
Cell line | Mutation details | Probe for labeling this protein in this cell | |||
---|---|---|---|---|---|
CCK81 | SNV: p.N274S | . | |||
DU145 | SNV: p.A186E | . | |||
MELJUSO | Insertion: p.S95GfsTer17 | . | |||
MEWO | SNV: p.A109P | DBIA Probe Info | |||
MOLT4 | SNV: p.L145M | . | |||
NUGC3 | Deletion: p.E57SfsTer40 | . |
Probe(s) Labeling This Target
ABPP Probe
Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
---|---|---|---|---|---|
DBIA Probe Info |
![]() |
C291(1.46) | LDD3310 | [1] |
Competitor(s) Related to This Target