Details of the Target
General Information of Target
| Target ID | LDTP07866 | |||||
|---|---|---|---|---|---|---|
| Target Name | Cytochrome P450 4V2 (CYP4V2) | |||||
| Gene Name | CYP4V2 | |||||
| Gene ID | 285440 | |||||
| Synonyms |
Cytochrome P450 4V2; Docosahexaenoic acid omega-hydroxylase CYP4V2; EC 1.14.14.79; Long-chain fatty acid omega-monooxygenase; EC 1.14.14.80 |
|||||
| 3D Structure | ||||||
| Sequence |
MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLV
GHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDK SSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKH INQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLW LDLWYLMFKEGWEHKKSLQILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFL DLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELD DVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAV IIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI LSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Cytochrome P450 family
|
|||||
| Subcellular location |
Endoplasmic reticulum membrane
|
|||||
| Function |
A cytochrome P450 monooxygenase involved in fatty acid metabolism in the eye. Catalyzes the omega-hydroxylation of polyunsaturated fatty acids (PUFAs) docosahexaenoate (DHA) and its precursor eicosapentaenoate (EPA), and may contribute to the homeostasis of these retinal PUFAs. Omega hydroxylates saturated fatty acids such as laurate, myristate and palmitate, the catalytic efficiency decreasing in the following order: myristate > laurate > palmitate (C14>C12>C16). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
| Cell line | Mutation details | Probe for labeling this protein in this cell | |||
|---|---|---|---|---|---|
| AN3CA | SNV: p.P58T | DBIA Probe Info | |||
| CCK81 | SNV: p.Y84C | DBIA Probe Info | |||
| IGR37 | SNV: p.S492F | . | |||
| IGR39 | SNV: p.S492F | . | |||
| JURKAT | SNV: p.V220I | . | |||
| KYSE30 | SNV: p.K471R | . | |||
| MFE280 | SNV: p.M123I | . | |||
| NCIH1155 | SNV: p.A273V | . | |||
| NCIH23 | Deletion: p.F445SfsTer24 SNV: p.R368L |
. | |||
| OVK18 | Insertion: p.Y191LfsTer12 | . | |||
| RL | SNV: p.S347C | . | |||
| SKN | SNV: p.F162L | DBIA Probe Info | |||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C282(0.96); C406(1.48) | LDD3320 | [1] | |
Competitor(s) Related to This Target

