Details of the Target
General Information of Target
| Target ID | LDTP07865 | |||||
|---|---|---|---|---|---|---|
| Target Name | Regulator of hemoglobinization and erythroid cell expansion protein (RHEX) | |||||
| Gene Name | RHEX | |||||
| Gene ID | 440712 | |||||
| Synonyms |
C1orf186; Regulator of hemoglobinization and erythroid cell expansion protein; Regulator of human erythroid cell expansion protein |
|||||
| 3D Structure | ||||||
| Sequence |
MLTEVMEVWHGLVIAVVSLFLQACFLTAINYLLSRHMAHKSEQILKAASLQVPRPSPGHH
HPPAVKEMKETQTERDIPMSDSLYRHDSDTPSDSLDSSCSSPPACQATEDVDYTQVVFSD PGELKNDSPLDYENIKEITDYVNVNPERHKPSFWYFVNPALSEPAEYDQVAM |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function | Acts as a signaling transduction factor of the EPO-EPOR signaling pathway promoting erythroid cell differentiation. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
NAIA_4 Probe Info |
![]() |
N.A. | LDD2226 | [1] | |

