Details of the Target
General Information of Target
| Target ID | LDTP07798 | |||||
|---|---|---|---|---|---|---|
| Target Name | TRAF-interacting protein with FHA domain-containing protein B (TIFAB) | |||||
| Gene Name | TIFAB | |||||
| Gene ID | 497189 | |||||
| Synonyms |
TRAF-interacting protein with FHA domain-containing protein B; TIFA-like protein |
|||||
| 3D Structure | ||||||
| Sequence |
MEKPLTVLRVSLYHPTLGPSAFANVPPRLQHDTSPLLLGRGQDAHLQLQLPRLSRRHLSL
EPYLEKGSALLAFCLKALSRKGCVWVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRVEEGT SLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQPPPGSG |
|||||
| Target Bioclass |
Other
|
|||||
| Function | Inhibits TIFA-mediated TRAF6 activation possibly by inducing a conformational change in TIFA. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C83(3.47) | LDD3333 | [1] | |
Competitor(s) Related to This Target