Details of the Target
General Information of Target
| Target ID | LDTP07771 | |||||
|---|---|---|---|---|---|---|
| Target Name | Interleukin-34 (IL34) | |||||
| Gene Name | IL34 | |||||
| Gene ID | 146433 | |||||
| Synonyms |
C16orf77; Interleukin-34; IL-34 |
|||||
| 3D Structure | ||||||
| Sequence |
MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPI
NYKISVPYEGVFRIANVTRLQRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQ EVETLLLNVQQGLTDVEVSPKVESVLSLLNAPGPNLKLVRPKALLDNCFRVMELLYCSCC KQSSVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPPWSPSSPPHSTGSVRPVRAQGEGL LP |
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
IL-34 family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Cytokine that promotes the proliferation, survival and differentiation of monocytes and macrophages. Promotes the release of pro-inflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, and in the regulation of bone resorption. Signaling via CSF1R and its downstream effectors stimulates phosphorylation of MAPK1/ERK2 AND MAPK3/ERK1.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
N.A. | LDD0241 | [1] | |
|
IA-alkyne Probe Info |
![]() |
N.A. | LDD0177 | [2] | |
The Interaction Atlas With This Target
References


