Details of the Target
General Information of Target
| Target ID | LDTP07751 | |||||
|---|---|---|---|---|---|---|
| Target Name | Calcium/manganese antiporter SLC30A10 (SLC30A10) | |||||
| Gene Name | SLC30A10 | |||||
| Gene ID | 55532 | |||||
| Synonyms |
ZNT10; ZNT8; Calcium/manganese antiporter SLC30A10; Solute carrier family 30 member 10; Zinc transporter 10; ZnT-10 |
|||||
| 3D Structure | ||||||
| Sequence |
MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYI
ARRPTRGFSATYGYARAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVG VLGLLVNVVGLLIFQDCAAWFACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAA DPTAPGSDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRG VLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYIDPSLTVLMVIIILSSAFPLIK ETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQ DASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGAL PLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYV NRTHF |
|||||
| Target Bioclass |
Transporter and channel
|
|||||
| Family |
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
|
|||||
| Subcellular location |
Cell membrane
|
|||||
| Function |
Calcium:manganese antiporter of the plasma membrane mediating the efflux of intracellular manganese coupled to an active extracellular calcium exchange. Required for intracellular manganese homeostasis, an essential cation for the function of several enzymes, including some crucially important for the metabolism of neurotransmitters and other neuronal metabolic pathways. Manganese can also be cytotoxic and induce oxidative stress, mitochondrial dysfunction and apoptosis. Could also have an intracellular zinc ion transporter activity, directly regulating intracellular zinc ion homeostasis and more indirectly various signaling pathway and biological processes.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
IPM Probe Info |
![]() |
N.A. | LDD0241 | [1] | |
|
W1 Probe Info |
![]() |
N.A. | LDD0236 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Transporter and channel


