Details of the Target
General Information of Target
| Target ID | LDTP07745 | |||||
|---|---|---|---|---|---|---|
| Target Name | Sclerostin domain-containing protein 1 (SOSTDC1) | |||||
| Gene Name | SOSTDC1 | |||||
| Gene ID | 25928 | |||||
| Synonyms |
USAG1; Sclerostin domain-containing protein 1; Ectodermal BMP inhibitor; Ectodin; Uterine sensitization-associated gene 1 protein; USAG-1 |
|||||
| 3D Structure | ||||||
| Sequence |
MLPPAIHFYLLPLACILMKSCLAFKNDATEILYSHVVKPVPAHPSSNSTLNQARNGGRHF
SNTGLDRNTRVQVGCRELRSTKYISDGQCTSISPLKELVCAGECLPLPVLPNWIGGGYGT KYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFE SMSPAKPVQHHRERKRASKSSKHSMS |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Sclerostin family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction Enhances Wnt signaling and inhibits TGF-beta signaling. Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C99(1.14) | LDD2343 | [1] | |
Competitor(s) Related to This Target