Details of the Target
General Information of Target
| Target ID | LDTP07737 | |||||
|---|---|---|---|---|---|---|
| Target Name | Developmental pluripotency-associated protein 3 (DPPA3) | |||||
| Gene Name | DPPA3 | |||||
| Gene ID | 359787 | |||||
| Synonyms |
STELLAR; Developmental pluripotency-associated protein 3; Stella-related protein |
|||||
| 3D Structure | ||||||
| Sequence |
MDPSQFNPTYIPGSPQMLTEENSRDDSGASQISSETLIKNLSNLTINASSESVSPLSEAL
LRRESVGAAVLREIEDEWLYSRRGVRTLLSVQREKMARLRYMLLGGVRTHERRPTNKEPK GVKKESRPFKCPCSFCVSNGWDPSENARIGNQDTKPLQP |
|||||
| Target Bioclass |
Other
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Primordial germ cell (PGCs)-specific protein involved in epigenetic chromatin reprogramming in the zygote following fertilization. In zygotes, DNA demethylation occurs selectively in the paternal pronucleus before the first cell division, while the adjacent maternal pronucleus and certain paternally-imprinted loci are protected from this process. Participates in protection of DNA methylation in the maternal pronucleus by preventing conversion of 5mC to 5hmC: specifically recognizes and binds histone H3 dimethylated at 'Lys-9' (H3K9me2) on maternal genome, and protects maternal genome from TET3-mediated conversion to 5hmC and subsequent DNA demethylation. Does not bind paternal chromatin, which is mainly packed into protamine and does not contain much H3K9me2 mark. Also protects imprinted loci that are marked with H3K9me2 in mature sperm from DNA demethylation in early embryogenesis. May be important for the totipotent/pluripotent states continuing through preimplantation development. Also involved in chromatin condensation in oocytogenesis.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
Phosphinate-6 Probe Info |
 |
N.A. | LDD0018 | [1] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Tribbles homolog 3 (TRIB3) | CAMK Ser/Thr protein kinase family | Q96RU7 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Nuclear pore glycoprotein p62 (NUP62) | Nucleoporin NSP1/NUP62 family | P37198 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Zinc finger protein 618 (ZNF618) | Krueppel C2H2-type zinc-finger protein family | Q5T7W0 | |||
Other