Details of the Target
General Information of Target
| Target ID | LDTP07700 | |||||
|---|---|---|---|---|---|---|
| Target Name | C-X-C motif chemokine 17 (CXCL17) |
|
||||
| Gene Name | CXCL17 | |||||
| Gene ID | 284340 | |||||
| Synonyms |
VCC1; C-X-C motif chemokine 17; 6-Cys CXCL17; Dendritic cell and monocyte chemokine-like protein; DMC; VEGF coregulated chemokine 1) [Cleaved into: 4-Cys CXCL17] |
|||||
| 3D Structure | ||||||
| Sequence |
MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAP
RRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL |
|||||
| Target Bioclass |
Cytokine and receptor
|
|||||
| Family |
Intercrine alpha (chemokine CxC) family
|
|||||
| Subcellular location |
Secreted
|
|||||
| Function |
Chemokine that acts as a chemoattractant for monocytes, macrophages and dendritic cells. Plays a role in angiogenesis and possibly in the development of tumors. Acts as an anti-inflammatory in the stomach. May play a role in the innate defense against infections. Activates the C-X-C chemokine receptor GPR35 to induce a rapid and transient rise in the level of intracellular calcium ions.; [4-Cys CXCL17]: Seems to exhibit much higher chemoattractant potency on monocytes and macrophages than 6-Cys CXCL17.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
 |
C103(4.04) | LDD3358 | [1] | |
Competitor(s) Related to This Target