Details of the Target

General Information of Target

Target ID LDTP07541
Target Name Kinesin light chain 3 (KLC3)
Gene Name KLC3
Gene ID 147700
Synonyms
KLC2; KLC2L; Kinesin light chain 3; KLC2-like; kinesin light chain 2
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MSVQVAAPGSAGLGPERLSPEELVRQTRQVVQGLEALRAEHHGLAGHLAEALAGQGPAAG
LEMLEEKQQVVSHSLEAIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLR
EELEETQRRLRASEESVAQLEEEKRHLEFLGQLRQYDPPAESQQSESPPRRDSLASLFPS
EEEERKGPEAAGAAAAQQGGYEIPARLRTLHNLVIQYAGQGRYEVAVPLCRQALEDLERS
SGHCHPDVATMLNILALVYRDQNKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVL
YGKRGRYREAEPLCQRALEIREKVLGADHPDVAKQLNNLALLCQNQGKFEDVERHYARAL
SIYEALGGPHDPNVAKTKNNLASAYLKQNKYQQAEELYKEILHKEDLPAPLGAPNTGTAG
DAEQALRRSSSLSKIRESIRRGSEKLVSRLRGEAAAGAAGMKRAMSLNTLNVDAPRAPGT
QFPSWHLDKAPRTLSASTQDLSPH
Target Bioclass
Other
Family
Kinesin light chain family
Subcellular location
Cytoplasm, cytoskeleton
Function
Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. Plays a role during spermiogenesis in the development of the sperm tail midpiece and in the normal function of spermatozoa. May play a role in the formation of the mitochondrial sheath formation in the developing spermatid midpiece.
Uniprot ID
Q6P597
Ensemble ID
ENST00000391946.7
HGNC ID
HGNC:20717

Probe(s) Labeling This Target

ABPP Probe
Click To Hide/Show 8 Probe Related to This Target
Probe name Structure Binding Site(Ratio) Interaction ID Ref
Probe 1
 Probe Info  		Y201(10.43)  LDD3495  [1]
DBIA
 Probe Info  		C365(1.39); C252(1.60)  LDD3310  [2]
Acrolein
 Probe Info  		N.A.  LDD0222  [3]
IA-alkyne
 Probe Info  		C343(0.00); C314(0.00); C230(0.00)  LDD0162  [4]
NAIA_5
 Probe Info  		C441(0.00); C474(0.00)  LDD2224  [5]
IPM
 Probe Info  		N.A.  LDD2156  [6]
TFBX
 Probe Info  		N.A.  LDD0148  [7]
AOyne
 Probe Info  		15.00  LDD0443  [8]

Competitor(s) Related to This Target

Competitor ID Name Cell line Binding Site(Ratio) Interaction ID Ref
 LDCM0108  Chloroacetamide HeLa N.A.  LDD0222  [3]
 LDCM0022  KB02 22RV1 C320(1.91); C474(1.29); C406(1.85); C334(1.59)  LDD2243  [2]
 LDCM0023  KB03 22RV1 C320(3.90); C474(1.83); C406(2.91); C334(4.13)  LDD2660  [2]
 LDCM0024  KB05 COLO792 C365(1.39); C252(1.60)  LDD3310  [2]

The Interaction Atlas With This Target

The Protein(s) Related To This Target

Enzyme
Click To Hide/Show 7 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Glutamine--tRNA ligase (QARS1) Class-I aminoacyl-tRNA synthetase family P47897
Probable E3 ubiquitin-protein ligase DTX2 (DTX2) Deltex family Q86UW9
Mitochondrial inner membrane protease ATP23 homolog (ATP23) Peptidase M76 family Q9Y6H3
Serine protease HTRA2, mitochondrial (HTRA2) Peptidase S1C family O43464
Fibroblast growth factor receptor 3 (FGFR3) Tyr protein kinase family P22607
Pterin-4-alpha-carbinolamine dehydratase 2 (PCBD2) Pterin-4-alpha-carbinolamine dehydratase family Q9H0N5
GTPase HRas (HRAS) Ras family P01112
Transporter and channel
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
14-3-3 protein zeta/delta (YWHAZ) 14-3-3 family P63104
Bardet-Biedl syndrome 5 protein (BBS5) BBS5 family Q8N3I7
Nucleoporin p58/p45 (NUP58) NUP58 family Q9BVL2
Peroxisome assembly protein 26 (PEX26) Peroxin-26 family Q7Z412
Transcription factor
Click To Hide/Show 4 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
Zinc finger protein 417 (ZNF417) Krueppel C2H2-type zinc-finger protein family Q8TAU3
Zinc finger protein 572 (ZNF572) Krueppel C2H2-type zinc-finger protein family Q7Z3I7
Krueppel-like factor 11 (KLF11) Sp1 C2H2-type zinc-finger protein family O14901
Transcription factor 4 (TCF4) . P15884
Other
Click To Hide/Show 21 Protein(s) Interacting with This Target
Protein name Family Uniprot ID
ABI gene family member 3 (ABI3) ABI family Q9P2A4
BICD family-like cargo adapter 2 (BICDL2) BICDR family A1A5D9
Centromere protein P (CENPP) CENP-P/CTF19 family Q6IPU0
Protein chibby homolog 2 (CBY2) Chibby family Q8NA61
Cyclin-H (CCNH) Cyclin family P51946
Heat shock-related 70 kDa protein 2 (HSPA2) Heat shock protein 70 family P54652
Keratin, type I cytoskeletal 15 (KRT15) Intermediate filament family P19012
Neurofilament light polypeptide (NEFL) Intermediate filament family P07196
Peripherin (PRPH) Intermediate filament family P41219
Harmonin-binding protein USHBP1 (USHBP1) MCC family Q8N6Y0
Kinetochore protein NDC80 homolog (NDC80) NDC80/HEC1 family O14777
Synaptosomal-associated protein 47 (SNAP47) SVAP1 family Q5SQN1
Syntaxin-11 (STX11) Syntaxin family O75558
Translin-associated protein X (TSNAX) Translin family Q99598
U3 small nucleolar ribonucleoprotein protein IMP3 (IMP3) Universal ribosomal protein uS4 family Q9NV31
Vacuolar protein sorting-associated protein 52 homolog (VPS52) VPS52 family Q8N1B4
Cancer/testis antigen 55 (CT55) . Q8WUE5
Interactor of HORMAD1 protein 1 (IHO1) . Q8IYA8
Kelch-like protein 21 (KLHL21) . Q9UJP4
Myomegalin (PDE4DIP) . Q5VU43
WW domain-containing adapter protein with coiled-coil (WAC) . Q9BTA9

References

1 An Azo Coupling-Based Chemoproteomic Approach to Systematically Profile the Tyrosine Reactivity in the Human Proteome. Anal Chem. 2021 Jul 27;93(29):10334-10342. doi: 10.1021/acs.analchem.1c01935. Epub 2021 Jul 12.
2 DrugMap: A quantitative pan-cancer analysis of cysteine ligandability. Cell. 2024 May 9;187(10):2536-2556.e30. doi: 10.1016/j.cell.2024.03.027. Epub 2024 Apr 22.
Mass spectrometry data entry: PXD047840
3 ACR-Based Probe for the Quantitative Profiling of Histidine Reactivity in the Human Proteome. J Am Chem Soc. 2023 Mar 8;145(9):5252-5260. doi: 10.1021/jacs.2c12653. Epub 2023 Feb 27.
4 SP3-FAIMS Chemoproteomics for High-Coverage Profiling of the Human Cysteinome*. Chembiochem. 2021 May 14;22(10):1841-1851. doi: 10.1002/cbic.202000870. Epub 2021 Feb 18.
Mass spectrometry data entry: PXD023056 , PXD023059 , PXD023058 , PXD023057 , PXD023060
5 N-Acryloylindole-alkyne (NAIA) enables imaging and profiling new ligandable cysteines and oxidized thiols by chemoproteomics. Nat Commun. 2023 Jun 15;14(1):3564. doi: 10.1038/s41467-023-39268-w.
Mass spectrometry data entry: PXD041264
6 Benchmarking Cleavable Biotin Tags for Peptide-Centric Chemoproteomics. J Proteome Res. 2022 May 6;21(5):1349-1358. doi: 10.1021/acs.jproteome.2c00174. Epub 2022 Apr 25.
Mass spectrometry data entry: PXD031019
7 Chemoproteomic Profiling by Cysteine Fluoroalkylation Reveals Myrocin G as an Inhibitor of the Nonhomologous End Joining DNA Repair Pathway. J Am Chem Soc. 2021 Dec 8;143(48):20332-20342. doi: 10.1021/jacs.1c09724. Epub 2021 Nov 24.
Mass spectrometry data entry: PXD029255
8 Chemoproteomic profiling of targets of lipid-derived electrophiles by bioorthogonal aminooxy probe. Redox Biol. 2017 Aug;12:712-718. doi: 10.1016/j.redox.2017.04.001. Epub 2017 Apr 5.