Details of the Target
General Information of Target
| Target ID | LDTP07528 | |||||
|---|---|---|---|---|---|---|
| Target Name | DnaJ homolog subfamily C member 24 (DNAJC24) | |||||
| Gene Name | DNAJC24 | |||||
| Gene ID | 120526 | |||||
| Synonyms |
DPH4; ZCSL3; DnaJ homolog subfamily C member 24; CSL-type zinc finger-containing protein 3; Diphthamide biosynthesis protein 4 |
|||||
| 3D Structure | ||||||
| Sequence |
MMAVEQMPKKDWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFI
EIDQAWKILGNEETKREYDLQRCEDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGK YSVSKDEAEEVSLISCDTCSLIIELLHYN |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
DPH4 family
|
|||||
| Subcellular location |
Cytoplasm, cytoskeleton
|
|||||
| Function |
Stimulates the ATPase activity of several Hsp70-type chaperones. This ability is enhanced by iron-binding. The iron-bound form is redox-active and can function as electron carrier. Plays a role in the diphthamide biosynthesis, a post-translational modification of histidine which occurs in translation elongation factor 2 (EEF2) which can be ADP-ribosylated by diphtheria toxin and by Pseudomonas exotoxin A (Eta).
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Target Site Mutations in Different Cell Lines
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
DBIA Probe Info |
![]() |
C55(2.79) | LDD3408 | [1] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0281 | AC21 | HEK-293T | C55(0.79) | LDD1520 | [2] |
| LDCM0289 | AC29 | HEK-293T | C55(0.93) | LDD1528 | [2] |
| LDCM0298 | AC37 | HEK-293T | C55(1.28) | LDD1537 | [2] |
| LDCM0307 | AC45 | HEK-293T | C55(0.97) | LDD1546 | [2] |
| LDCM0312 | AC5 | HEK-293T | C55(0.98) | LDD1551 | [2] |
| LDCM0316 | AC53 | HEK-293T | C55(1.10) | LDD1555 | [2] |
| LDCM0325 | AC61 | HEK-293T | C55(1.19) | LDD1564 | [2] |
| LDCM0248 | AKOS034007472 | HEK-293T | C55(1.05) | LDD1511 | [2] |
| LDCM0409 | CL21 | HEK-293T | C55(1.39) | LDD1613 | [2] |
| LDCM0422 | CL33 | HEK-293T | C55(0.91) | LDD1626 | [2] |
| LDCM0435 | CL45 | HEK-293T | C55(1.21) | LDD1639 | [2] |
| LDCM0448 | CL57 | HEK-293T | C55(1.19) | LDD1651 | [2] |
| LDCM0461 | CL69 | HEK-293T | C55(1.52) | LDD1664 | [2] |
| LDCM0475 | CL81 | HEK-293T | C55(1.68) | LDD1678 | [2] |
| LDCM0484 | CL9 | HEK-293T | C55(1.30) | LDD1687 | [2] |
| LDCM0488 | CL93 | HEK-293T | C55(1.63) | LDD1691 | [2] |
| LDCM0022 | KB02 | A3-KAW | C55(2.77) | LDD2257 | [1] |
| LDCM0023 | KB03 | A3-KAW | C55(1.40) | LDD2674 | [1] |
| LDCM0024 | KB05 | RL | C55(2.79) | LDD3408 | [1] |
References

