Details of the Target
General Information of Target
| Target ID | LDTP07489 | |||||
|---|---|---|---|---|---|---|
| Target Name | Histone H3.3C (H3-5) | |||||
| Gene Name | H3-5 | |||||
| Gene ID | 440093 | |||||
| Synonyms |
H3F3C; Histone H3.3C; Histone H3.5 |
|||||
| 3D Structure | ||||||
| Sequence |
MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGVKPHRYRPGTVALREIRRYQKSTEL
LIRKLPFQRLVREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIM PKDIQLARRIRGERA |
|||||
| Target Bioclass |
Other
|
|||||
| Family |
Histone H3 family
|
|||||
| Subcellular location |
Nucleus
|
|||||
| Function |
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Hominid-specific H3.5/H3F3C preferentially colocalizes with euchromatin, and it is associated with actively transcribed genes.
|
|||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
YN-1 Probe Info |
![]() |
100.00 | LDD0444 | [1] | |
|
STPyne Probe Info |
![]() |
K122(20.00) | LDD2217 | [2] | |
PAL-AfBPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STS-2 Probe Info |
![]() |
N.A. | LDD0139 | [3] | |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Heme oxygenase 2 (HMOX2) | Heme oxygenase family | P30519 | |||
| Caspase-6 (CASP6) | Peptidase C14A family | P55212 | |||
| GTP-binding nuclear protein Ran (RAN) | Ran family | P62826 | |||
Transporter and channel
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Endophilin-B1 (SH3GLB1) | Endophilin family | Q9Y371 | |||
| Huntingtin (HTT) | Huntingtin family | P42858 | |||
| Wolframin (WFS1) | . | O76024 | |||
Transcription factor
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Krueppel-like factor 11 (KLF11) | Sp1 C2H2-type zinc-finger protein family | O14901 | |||
Immunoglobulin
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Intercellular adhesion molecule 5 (ICAM5) | ICAM family | Q9UMF0 | |||
| Limbic system-associated membrane protein (LSAMP) | IgLON family | Q13449 | |||
Other
References



