Details of the Target
General Information of Target
| Target ID | LDTP07488 | |||||
|---|---|---|---|---|---|---|
| Target Name | Protein phosphatase inhibitor 2 family member B (PPP1R2B) | |||||
| Gene Name | PPP1R2B | |||||
| Synonyms |
PPP1R2P3; Protein phosphatase inhibitor 2 family member B; PPP1R2 family member B; Protein phosphatase 1, regulatory subunit 2 pseudogene 3; Protein phosphatase inhibitor 2-like protein 3 |
|||||
| 3D Structure | ||||||
| Sequence |
MAASTASHRPIKGILKNKTSTTSSMVASAEQPRRSVDEELSKKSQKWDEINILATYHPAD
KGYGLMKIDEPSPPYHSMMGDDEDACRDTETTEAMAPDILAKKLAAAEGLEPKYRIQEQE SSGEEDSDLSPEEREKKRQFEMRRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADG ESMNTEESNQGSTPSDQQQNKLRSS |
|||||
| Target Bioclass |
Enzyme
|
|||||
| Family |
Protein phosphatase inhibitor 2 family
|
|||||
| Function | Inhibitor of protein-phosphatase 1. | |||||
| Uniprot ID | ||||||
| Ensemble ID | ||||||
| HGNC ID | ||||||
Probe(s) Labeling This Target
ABPP Probe
| Probe name | Structure | Binding Site(Ratio) | Interaction ID | Ref | |
|---|---|---|---|---|---|
|
STPyne Probe Info |
![]() |
K145(0.84) | LDD0277 | [1] | |
|
HHS-475 Probe Info |
![]() |
Y148(0.81) | LDD0264 | [2] | |
|
Acrolein Probe Info |
![]() |
N.A. | LDD0226 | [3] | |
|
ATP probe Probe Info |
![]() |
N.A. | LDD0199 | [4] | |
|
HHS-465 Probe Info |
![]() |
N.A. | LDD2240 | [5] | |
Competitor(s) Related to This Target
| Competitor ID | Name | Cell line | Binding Site(Ratio) | Interaction ID | Ref |
|---|---|---|---|---|---|
| LDCM0116 | HHS-0101 | DM93 | Y148(0.81) | LDD0264 | [2] |
| LDCM0117 | HHS-0201 | DM93 | Y148(0.64) | LDD0265 | [2] |
| LDCM0118 | HHS-0301 | DM93 | Y148(0.71) | LDD0266 | [2] |
| LDCM0119 | HHS-0401 | DM93 | Y148(0.71) | LDD0267 | [2] |
| LDCM0120 | HHS-0701 | DM93 | Y148(0.83) | LDD0268 | [2] |
| LDCM0109 | NEM | HeLa | N.A. | LDD0226 | [3] |
The Interaction Atlas With This Target
The Protein(s) Related To This Target
Enzyme
Other
| Protein name | Family | Uniprot ID | |||
|---|---|---|---|---|---|
| Histone H2B type W-T (H2BW1) | Histone H2B family | Q7Z2G1 | |||
References





